KEGG   Pseudoalteromonas rubra: AT705_06590
Entry
AT705_06590       CDS       T04179                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00333  Prodigiosin biosynthesis
prr01100  Metabolic pathways
prr01110  Biosynthesis of secondary metabolites
Module
prr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AT705_06590
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: ALU42650
UniProt: A0A0U3GCW9
LinkDB
Position
1:1480126..1482774
AA seq 882 aa
MSQSLVVALSGNEQLELGHLGGKGHSLNHLIRAGLPVPPAFCITAEAYQTFVNTALPDDL
LSAPELDKVRDTILSADIPEQLRTAIASAYQGLGDNAQIAVRSSALDEDGQSQSFAGQYE
TYLHVQGNDSVMDKVRACWASLWAERAAGYRNSSAADTAIAVVLQTMVDADAAGVMFTQD
PLSGDTNKVVIDSCWGLGEGVVSGQVSTDSFILDKNSGELLQKEIRVKPQYCQRNAQGQV
TLLNTPQAQQQSASLNEAQLAQLLTLAKQAQALYQTELDIEWALKDNKIWLLQARPVTTQ
ASKAEPIYANPWEQDQRIKDGAFFSRMDTGEIVTGLMTPLGLSFCEFYQKHIHGPAIKTM
GLADISDWQVYMGYIQGQVYLNISGSAHMLRQCPPTRDEMKFTIRYATSDIDFSNYHNPY
GPGVEGWDYAKSAWHWLKQQVHNMRNAGKIVDEMIALRESETKRFLALDLPSMSLNELDQ
ELTRIDNYFLDSCAAYMPFFLQSFALYDALAETCEEHFKDQGEGLQNRIKASMNNLRTIE
VTRGILDLVEQVQGNPELKAVFERFEAEELVSILPAHPLGQPFWQGPFEAFLLEFGARGR
QEFELSIPRWRDDPSYLLQVMKMYLKHPVDLEKKLKETESLREADSEQLFKALPAGARFK
LKTIIKLYGVMAERREATRPTFITETWFYRCIILEVLSRLERDNLAKVADLPYIDFNRLR
DYVAGRMGAAEAFSESLLNANRHSHLFNLHAEEPPMAIIGPYTPKMKATAQTHSDSMSGL
AASPGKIVAKARVITDLQAQAGDLEPGEILVARFTDASWTPLFALASGVVTDIGSTLSHS
CIVAREFGIPAVVNLHSATQAIKSGDTLILDGDQGTVIIQRE
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgagccaatcactcgtcgttgccctcagtggcaacgaacaactggaattaggtcactta
ggcggcaaaggccactcactgaatcacttgatccgtgctggcctgcccgtaccacccgct
ttttgtattactgcagaggcctatcagacctttgttaataccgcattgccggatgacttg
ctcagtgcacctgagctagataaagtgcgagatactatcctcagtgccgatattcctgag
cagctacgtaccgcgattgcatcagcctatcaggggctgggtgacaatgcccagatagcc
gttcgttcgtccgcactggacgaagatggccagagccagagttttgctggtcagtacgaa
acctatctgcatgtgcagggcaatgacagtgtaatggacaaagtgcgcgcatgctgggct
tccttgtgggcagaacgtgcagccggatatcgcaacagcagtgcggcggataccgccatt
gccgtggtgctgcaaaccatggtggatgccgatgcagccggcgtgatgttcactcaggac
ccgctcagtggcgacaccaataaagtggtcatagatagctgctggggtctgggcgaaggt
gtggtatccgggcaagtgagcaccgacagctttatcctcgacaaaaacagcggtgagctg
ctgcaaaaggagatccgcgttaagccccagtattgtcagcgcaacgcacaaggtcaggtt
accttgctgaataccccacaggcgcaacaacagtcagccagtctgaacgaagctcagctc
gcacagttgctcactttggctaagcaggcacaggcactctatcagaccgaactggacatt
gagtgggccctgaaggacaacaagatctggctactccaggcgcgcccggttaccactcag
gcgagtaaagcagaacctatttatgcgaacccctgggaacaggaccagcgtattaaagac
ggtgcattcttttctcgtatggacaccggtgaaatcgtcaccggactcatgaccccactc
ggcctgtcattttgtgagttctatcaaaagcacattcatggtccggccatcaaaactatg
ggcctggctgacatcagcgactggcaagtttacatgggctacattcagggtcaggtatac
ctgaatatctccggctccgcgcacatgctgcgccagtgtccacccacccgggatgagatg
aaatttactatccgctatgccacgtcagatatcgatttcagcaactaccataacccttat
gggccaggagttgagggctgggattatgcaaaaagtgcctggcattggttaaaacagcaa
gttcacaatatgcgcaatgccggtaaaattgtggatgagatgattgcgctgcgcgaaagc
gaaacgaagcgctttttggccctggatctgcccagtatgtcactcaatgagctggaccag
gagctgacccgtatcgacaactactttttagactcctgtgccgcctacatgcctttcttt
ttacagtcatttgcgctgtacgatgcactggccgaaacctgtgaagaacacttcaaagat
cagggcgaagggcttcagaatcgcatcaaagcctcgatgaacaatctgcggaccatagaa
gtaacacgggggatcctggatctcgtcgaacaagttcaaggtaaccctgaactaaaagcc
gtatttgagcgatttgaggcagaagaactggtaagcatcctccccgcacacccgctggga
caaccattctggcaggggccctttgaagcctttttgctcgaatttggcgcccgtggccgt
caggagtttgaattaagtattccacgctggcgcgacgaccccagttatttgttacaggtc
atgaaaatgtatctgaaacacccggtcgatctggagaaaaaactcaaagagaccgaaagt
ttgcgcgaagccgacagcgagcaactctttaaagctttacccgccggcgcgcgttttaaa
ctcaagaccattatcaaactgtatggggtgatggcagaacgccgtgaagcgactcgccct
acctttattacagagacctggttctatcgctgcatcattcttgaagtgctgtcgcgcctg
gaacgagacaatctggcgaaagtagccgacttaccctatatcgatttcaatcgcctgcgt
gattatgttgccggacgcatgggagcggctgaagcgttcagcgaatccctactcaatgcc
aaccgccacagtcatttattcaacttacatgctgaagagccccccatggcaatcattggc
ccatacacaccaaaaatgaaggccacggcacaaacacacagcgattcaatgagtggccta
gccgccagtcccggaaaaatagtcgctaaggcacgggtgatcaccgatctgcaagcacag
gctggtgacctggagcctggagaaattttggtcgcacgctttaccgatgccagctggacg
cctttatttgcactcgccagcggggttgtcacggacatcggctccacgctatcgcatagc
tgtattgtggcgcgtgaatttggtattccggctgtcgtgaacttacacagtgcaacccag
gcgattaaaagtggcgacacgctgatactcgacggagaccagggcacagtgatcattcag
cgggaataa

DBGET integrated database retrieval system