KEGG   Pseudoalteromonas rubra: AT705_06600
Entry
AT705_06600       CDS       T04179                                 
Name
(GenBank) acetylornithine aminotransferase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00333  Prodigiosin biosynthesis
prr01100  Metabolic pathways
prr01110  Biosynthesis of secondary metabolites
Module
prr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AT705_06600
Enzymes [BR:prr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     AT705_06600
SSDB
Motif
Pfam: Aminotran_3 Diacid_rec AI-2E_transport
Other DBs
NCBI-ProteinID: ALU42652
UniProt: A0A0U3IGU7
LinkDB
Position
1:1485467..1488019
AA seq 850 aa
MKFGFIAHPTSVGLKRYVKMLDLLQRNTQDQHTGYNRELWGKANLVPFMNFAKITSASGA
TCEGMIKYMPLIAEEMIADPRAIAERVVAGVEEFVADGAELVGLGGFTSIVGRRGEATAA
KSPIPITSGNSLTTYAGYKALMQIKEWLDINPEKETVAIVGYPGSICLALSRLLLAEGFN
LKLLHRAGHKDKAEMLSHLPEQYHQRVSLTGNPDDLYDECKLFAGATSAGGVIDVAKLQP
GSIFIDVALPRDVNVDARPARDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALEQRRENYSLGRYLEPVKVLEIGELAEKHGFYAYPLASFGERIDRQHVTNLKRYYH
QDIYAIDKGDTSQRLTFIDNIIAQDPAKEDTLDRHHQFINPMMVEFLKQQRCDNVFRKAQ
GTMLYDNDGTGYLDMVAGYGCLNLGHNPSAVSQAVKTFLDEQGPNFIQYISVPEHTAKLA
EVLCHLAPGNMGRVFFSNSGTEAVEAAIKLAKAATGKPGIAYLKNSYHGKTLGALSITGR
EKHRKYFQPLIQTMVEVPFADLDALREALQRDDVGALMLEPIQGEGGVHVPPAGYLSAVQ
QICRDTGTLLMVDEIQTGLARTGKLFACEWEGIEPDVLMLSKSLSGGLLPIGATLCRSDV
WQRAYGTSDRFLVHTSTFGGGNLASVAALTALREIVAQDLAARADELGSYFKSELQAIAG
QYPFIAEIRGQGLMLGIQFEQTFDGAVAASAREFATRLPGDWHSTWKFLPDPVREHLQAA
MTRMEQTLGEMFCLKFVTKFCLDHQILTFVTANSSTVIRIQPPLVISKPEIDRFVSAFAS
VCEELSTFLD
NT seq 2553 nt   +upstreamnt  +downstreamnt
atgaagtttggatttatcgcccacccgacctcagtcggcctgaaacgttacgtgaaaatg
ctcgatctactacaacgtaacacccaagatcagcataccggctataaccgtgaactgtgg
ggcaaagcaaacctggtgccctttatgaactttgccaaaatcacgtccgccagcggcgca
acctgtgaaggcatgatcaaatatatgccactgatcgccgaggaaatgattgccgatccc
agagcaattgctgaacgtgttgttgcgggcgtagaagagtttgtcgccgacggtgcagag
ttagttggcctgggaggatttacctccatagttggtcgtcgtggtgaagccacggccgcc
aaatcccccattcccattacctcagggaactcactgaccacctatgccggctacaaagcc
ctgatgcaaattaaagaatggctggacattaatccggaaaaagaaaccgtcgccattgtg
ggttatccaggttccatttgcctggcactcagccgattactgctcgccgagggctttaac
ttgaaactgctgcaccgcgccggtcacaaagacaaagcggaaatgctcagtcacctgccc
gagcagtatcaccagcgggtttccctgactggcaacccggacgacctgtacgacgagtgc
aaactatttgccggtgccacctcagccggaggcgtgattgatgtggccaagctacaacct
ggctccattttcatcgatgtggcactgccacgcgacgtcaatgtggatgcccgccctgcc
cgtgacgacattttgatcatcgacggtggctgtgtcacagccaccgatgcggtcaaattg
ggaggagagtcactgaatgtcaccattaaacagcagctcaacgggtgtatggcagagacc
attgtcctggccctggagcagcgccgggagaattactctctgggccgttacctggaaccg
gtcaaagtgcttgaaattggtgaactggctgagaaacatggcttttatgcctatccgctt
gcctcttttggtgaacgcattgaccgccagcacgtcaccaacctgaagcgctattatcat
caggacatctatgccatcgacaagggcgacaccagtcagcgcctgacctttatcgacaac
atcattgcccaggatccggccaaagaagacacgctggaccgccatcaccagtttattaac
ccaatgatggtggagtttttaaaacaacaacgctgcgacaatgtgttccgcaaggcacaa
ggcaccatgctgtacgataacgacggcacaggctatctcgatatggtcgcgggctatggc
tgccttaatctgggtcacaaccccagcgccgtcagccaggcagtcaaaaccttcctggat
gagcaaggtcccaacttcattcaatatatttccgtgccggaacacaccgccaaactggct
gaagtcctctgccacctggcacctggcaatatgggccgcgtgtttttcagtaactcagga
acagaagccgtagaagccgccattaaactggccaaagccgccaccggtaagccaggcatt
gcttatctgaaaaacagctaccatggtaaaacgctcggcgccttgtctatcacaggacgg
gaaaaacaccgtaaatactttcagccactgatccagaccatggtcgaagtgccctttgcc
gacctcgacgctttacgcgaagccctgcaaagagacgatgtgggtgcactcatgctggag
cccatccagggggaaggcggtgtccacgtgccaccagccggatacctgagcgcggtgcaa
cagatctgtcgcgataccggcactttgctgatggtcgatgagatacagactggcctggcc
cgcaccggcaaactctttgcctgtgagtgggaaggcattgagcctgacgtgctgatgctg
tccaagtcactgtccggtggtttattgcccattggcgccactttgtgccgcagcgatgtc
tggcagcgagcttacggcacctctgatcgcttcttagtacacacctccacctttggcggc
ggtaacctggcttctgtcgccgcactcacggcactgcgagaaattgtcgcacaagattta
gcagcccgtgctgatgagctgggcagctattttaaatctgagctacaagccatcgccggc
cagtacccctttatcgccgaaattcggggccagggcctgatgctggggatccagtttgaa
cagacctttgacggcgcagttgccgcttctgccagagagtttgctacccgtctgccgggt
gactggcatagcacctggaaattcttacccgatccggtgcgcgaacatctgcaagccgct
atgacacgcatggagcaaacgctgggagaaatgttctgcctgaagtttgtcactaagttc
tgcctggatcatcaaatcctcacctttgttactgccaacagttcaacggtgatccggatc
cagccgccattggtgatcagcaaacccgagattgaccgctttgtcagcgcttttgccagt
gtctgcgaagagctttcgacctttttagactaa

DBGET integrated database retrieval system