KEGG   Pyrgilauda ruficollis (rufous-necked snowfinch): 121358459
Entry
121358459         CDS       T07608                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
pruf  Pyrgilauda ruficollis (rufous-necked snowfinch)
Pathway
pruf04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pruf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    121358459 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pruf04050]
    121358459 (TNFRSF8)
   04090 CD molecules [BR:pruf04090]
    121358459 (TNFRSF8)
Cytokine receptors [BR:pruf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   121358459 (TNFRSF8)
CD molecules [BR:pruf04090]
 Proteins
  121358459 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 DUF2339
Other DBs
NCBI-GeneID: 121358459
NCBI-ProteinID: XP_041332593
LinkDB
Position
Unknown
AA seq 503 aa
MAACSLPLGLWLLLLLQDIQTAPQTSLTPPHSCDTVKDWFYDETSQNCCYQCPSGYVKKK
ACPQDPAEDCMTCGPNQYLSNESQKPRCDACVSCSKELDLVEKQPCSFRSSRVCECRPGL
FCRLPVLNSCSRCQHHSACEPGFGVKIRGTARNDVTCEECPPGTFSAQSSSTDSCKPHTN
CAKLNKAMLRKGNATHDQVCLDQLPTYLTPSTLSMRFSNETNNFDLRMFKENLVTSASGD
LSVTTAENPSSTPEEKAQAGTSPTSAKGKMTIGGVVLWAVVLSVAVLLGAMLVFWKWKVC
KRRMLVLRRKPHLQSVIAHKYVLRSQGEKILWTCSVQSVFTLTPLLLSCFCWQKIKLTTD
TGLEEEELIDRALPLETNNNLVSSTEKAQSPPRSVTDVAPSSGNAPDCPVDSRVRDHTNN
RIEKLYIMKADTVIVGTVSEVPSGKNCAVKGCENNLDAQESMEEELEMHYPEQETESFPG
NDVMVPVEEEGKEFHHPTTATEK
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggctgcctgcagcctgcctctgggactgtggctcctgctgctgctccaggacatccag
acagccccacagacatcattaaccccacctcattcctgtgatacagtaaaggattggttc
tatgatgaaacttcacaaaactgctgttaccagtgtccctcaggctatgttaaaaagaaa
gcatgtcctcaggatccagctgaagactgcatgacatgtgggcctaatcagtatttgagc
aatgaatcccaaaagccacgatgtgatgcctgtgtgtcatgctcaaaagagctggacctg
gtggagaagcagccctgctccttccgctccagccgcgtgtgcgagtgccggccggggctc
ttctgccggctgcccgtcctcaacagctgctcccgctgccagcaccactctgcctgcgag
cctggcttcggagtcaaaatcaggggcaccgcaaggaatgatgtcacgtgtgaagagtgc
cctcccgggaccttctctgctcaaagctccagcacagacagctgcaaaccccacaccaac
tgtgccaagctgaacaaagcaatgttaaggaaaggaaatgctacacacgaccaagtttgc
ctggaccagttgcccacttacctcaccccaagcactttgtccatgagattcagcaatgaa
acaaataactttgacctgaggatgtttaaggagaacctggtgacctctgctagtggtgac
ctaagtgtcacaacagctgaaaatcccagttcaactcctgaggagaaagctcaggctggc
acttctcccacctcagccaaggggaagatgacaataggaggtgtggtgctctgggcagtg
gtcctctccgtggcagtgctccttggggccatgctggtgttttggaagtggaaggtttgc
aagaggcggatgctggtgctcagaagaaagccacacctgcagtcggtcatcgcacacaaa
tacgtgctcagatctcaaggtgagaagattctgtggacctgcagtgtccaaagtgttttt
acactcaccccactcctgctctcctgtttctgttggcagaagatcaaactgaccactgac
actgggctggaagaggaggagttaattgacagagcccttcctttggaaaccaacaataac
ttggtgtccagcacagaaaaagcccagagtcctcctcggagtgtgactgatgtggctcca
agcagtgggaatgccccagattgccctgtggattctcgagtcagggaccacacaaataac
agaattgaaaaactctacatcatgaaggcagacactgttatcgtggggactgtttcagaa
gtgcccagtggcaagaactgtgctgttaaaggatgtgaaaataacctcgatgcccaggaa
agcatggaagaggagctggaaatgcactacccagagcaggagacagagtcttttccaggg
aatgatgtgatggttcctgtggaagaggagggaaaggaatttcaccaccctaccactgcc
actgagaagtga

DBGET integrated database retrieval system