KEGG   Pseudoalteromonas sp. A25: PA25_35600
Entry
PA25_35600        CDS       T07990                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
psaz  Pseudoalteromonas sp. A25
Pathway
psaz00333  Prodigiosin biosynthesis
psaz01100  Metabolic pathways
psaz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psaz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PA25_35600
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase CTP-dep_RFKase
Other DBs
NCBI-ProteinID: BBN83575
UniProt: A0A5H2Y682
LinkDB
Position
2:392081..393163
AA seq 360 aa
MTHCKPLANVVSECIELAKLVPSSHNCQPWRVHLHHAGMPFDGTLNISIDSEHTINALSS
LKNEMLMSLAGFSCALINLLEASGVVCEVQSNTANLSVIDNEDTQVFSVYLTLKPDSEDK
TRFVRLSQLLQNRYTHRGELHTDKPLQWQQDILATKLWPNEQLHWLKVTSQKQTQIAKLV
ARFAALDFSHRKAWQETYQFIDFAKGKHVKKERGFNIQQLMGPMSAFKRRINQLLLHPNT
MLVLNKFGMAQKMADMLAMLSEQSAQLICLCHSNKADTTAWLAAGEYMLEAWLQATEQQL
AVHPLSVLLQHSDAKTALHHTLGAQHSPMFIARVGKSNAEQSFIAQFRYRTSLSRILTQH
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgactcattgcaagccgttagctaacgttgttagcgaatgtattgagctggctaaactg
gtgccctcatcacacaattgccagccttggcgcgtacatttgcaccacgcaggtatgcct
tttgatggcacgctgaacataagcattgatagtgagcatactatcaatgcgctcagttca
ttaaaaaatgaaatgctaatgagcttggcaggtttcagctgcgctttaatcaacttgtta
gaagcgtcaggtgtagtgtgtgaggtacaaagcaataccgctaacttaagtgtcattgat
aacgaagatacgcaggtatttagtgtgtatctgacattaaaaccagatagcgaagacaaa
actcgttttgtacgcttaagccagttattgcaaaaccgctatacacaccgtggtgagcta
catacagataaaccgctgcaatggcaacaagacatacttgcaaccaaactttggcctaat
gagcaattacattggctcaaagtaacgtcacaaaagcaaactcaaatagctaagttagtg
gcgcgttttgccgcattggattttagccaccgaaaggcatggcaagaaacctatcagttt
atcgactttgccaaaggtaaacacgtcaaaaaagagcgtggttttaatatacaacagcta
atgggcccaatgagtgcgttcaagcgtcgtattaatcaactactgttgcacccgaatacc
atgcttgtactaaacaaatttggcatggcacaaaaaatggccgacatgctagctatgtta
agcgaacaaagcgctcagctcatttgcttgtgtcacagtaataaagccgatactaccgct
tggttggctgctggagaatatatgctcgaagcttggttacaagcaacagagcagcaactt
gcagtacatccattaagtgtactgttacaacactctgacgccaaaacagcactacatcac
acattaggcgcacaacatagcccgatgtttatcgcacgcgtaggcaagagtaatgctgag
caaagtttcattgctcagtttcgctatcgcacctctttatctcgaatactaacgcaacac
taa

DBGET integrated database retrieval system