KEGG   Pseudoalteromonas sp. A25: PA25_35670
Entry
PA25_35670        CDS       T07990                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
psaz  Pseudoalteromonas sp. A25
Pathway
psaz00333  Prodigiosin biosynthesis
psaz01100  Metabolic pathways
psaz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psaz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PA25_35670
SSDB
Motif
Pfam: PPDK_N PEP-utilizers PBSX_XtrA
Other DBs
NCBI-ProteinID: BBN83582
UniProt: A0A5H2YES9
LinkDB
Position
2:399568..402270
AA seq 900 aa
MNNTVVKSSTSITEHVVGFANAPKNNVSLFGGKGAVLCDLYQAGLPVPNGFCISIDMFKA
FIAHYDLLAKHPINEGIEQWRSLAKAIIESSMPSELADLITCELVNLSGPVAVRSSATDE
DGQSHSFAGQHLTKLGQQGESEILDAVKACWASAFSDAAYEYRKATGQQTELPTMAVVVQ
QMKFGDVSGVAFGQHPTSLNKNEFLIEGCFGLCEGLVSGQVSSDSFVIDKQTNELISQSI
QNKQQQIVYLDGQIKKVDIPKQMQSEPTLDPMTIKSLGKLLHQVEDFYGKAQDVEWTLSE
GKLWLLQSRPITSIAQDNSDDNFYLGNRSEQLQKDILWSRMDIGEIFTGRMTPLGLSFAR
YYQSNVHIECGKGLGLLDLGEADETMAYYRGHVYLNVSYTAWQLAQTPVGKDQTPFLVRF
SSEAIDLTGYKNPYGEQHSHPNYSSGQCVRHWIKQNIREFFQAKRRAKTMVESRFREYDR
VQLQNIDAMDLSALQREMTHALKYFKAMHEGYLPYYINAFACYGLLEELSAQWLGDKSKH
LQNQIKGDMSNLRTVASAQELWQLCQTLEQWPNVRDAFASQTISEIDSFLNNTTEGLRFS
QGPLAKFMRENGVRAREEMELTHPRWLDDRTYVLQMIKLYLAQGYEVDEALQQQQQQQQL
TSEDLLKELSWSKRWVIKRVIALYCGCAKLREETRMSMITSIWLVRRVVFEVAKRLVEAK
HLDHIDDVAYLNFEQILQYLEGMISATELTSNQALQARRAQYQSWLARPEPPLTFIGKPS
SQPDLILDPTATSLQGLATSKGFIEGKACVITDLANQVGEFKKGDILIAPFTDASWTPLF
ALASAVVTDIGSMLSHSSIVAREFGIPCVVNTNHASALIKTGDHIIVDAETGLITLKKDD
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgaacaacacggtggttaaatcttcaacttccataaccgagcacgtagtaggctttgcc
aacgcacccaaaaataatgtatcgctatttgggggcaaaggggccgtgctatgcgaccta
tatcaagcaggactgcctgtacccaacgggttttgtattagtattgacatgtttaaagca
tttatcgctcattatgacctgcttgctaaacatcccatcaatgaaggtattgaacaatgg
cgcagtttggcaaaggccattattgaaagttcaatgccaagcgagctggcagacttgata
acctgtgaactggttaatctaagtgggccggtcgcagtgcgctcatcagccaccgatgaa
gacggtcaaagccactcttttgctgggcagcatttaactaagcttggtcagcaaggcgag
agtgaaatactcgatgcagtgaaggcttgctgggcgtctgcatttagtgatgcggcatat
gaataccgcaaagccacgggtcaacaaactgaactccctaccatggcggttgttgttcaa
caaatgaagtttggcgatgtctcgggggtcgcgtttggtcaacacccaaccagcctcaat
aaaaacgaatttttaatcgaaggctgctttggtctatgtgagggactcgtatcagggcaa
gtcagcagcgacagctttgttatcgacaagcaaaccaacgagcttatctctcagtcgatt
caaaacaagcaacagcaaattgtgtatctcgatgggcaaatcaaaaaagtggatattcca
aagcagatgcaaagtgagcccactttagaccctatgaccattaaaagtctgggcaaactc
ctgcaccaagttgaagacttttacggtaaagcccaagatgttgagtggacgcttagcgaa
ggcaaattatggttgctgcaaagccgacctatcacttctattgcccaagacaatagcgat
gacaatttctatttaggcaaccgctctgagcagctgcaaaaagatatcttatggtcacgt
atggatatcggtgagatttttaccggccgtatgacgccactgggtttgtcttttgctcgt
tattatcaaagcaacgtacatattgagtgcggtaaagggctgggcttactagatttaggt
gaagccgacgaaaccatggcttactatcgcggtcacgtttatcttaatgtctcttatacc
gcttggcagcttgcacaaactccggtcgggaaagaccaaacaccatttttagtgcgcttt
agtagcgaagcaattgacttaactggttataaaaacccttatggtgagcagcactcacac
ccaaactattcatcaggacaatgtgttcgtcattggataaagcaaaatatccgcgagttt
ttccaagccaaacgtcgcgctaaaaccatggttgagtcacgctttagagaatatgaccgt
gtgcagctacaaaacatcgacgccatggacttaagcgcgctacaacgcgaaatgacccat
gcactcaaatactttaaagccatgcatgaaggttacctgccctactatattaatgcattt
gcttgttatgggctgttagaagaactcagtgctcagtggcttggcgacaaaagtaagcac
ttgcaaaatcaaataaaaggcgacatgtctaacttacgcactgttgccagtgcacaagag
ctttggcaattgtgccaaacgttagaacaatggccaaacgtacgtgatgcatttgccagt
caaaccatcagcgaaatagatagctttttaaacaacaccacagaagggctacgattttca
caaggtcctttggctaaatttatgcgggaaaatggcgtacgagcgcgtgaagaaatggag
cttacccaccctcgttggttagacgaccgcacctatgttttacaaatgatcaaattgtac
ctagcacaagggtatgaagttgacgaggcactacaacagcaacagcagcaacaacaatta
accagtgaagacttgctcaaagaacttagctggtcaaaacgttgggtgattaagcgtgtt
atcgccttgtactgtggctgtgccaagctacgagaagaaacccgcatgagtatgatcacc
tctatttggttagtgcgccgcgtcgtttttgaagtagcaaaacgcctggtagaagcaaag
catttagatcatattgatgacgttgcatatctaaacttcgagcaaatattgcaatactta
gagggaatgataagcgctacggaattaacctctaaccaagcgcttcaagcccgccgcgca
caatatcaaagctggctcgctcgcccagagccgccactaacttttatcggcaaaccaagc
agtcagcccgatttgatccttgacccaactgcgacgtcactccaaggacttgcaacatcg
aaaggttttatcgaaggaaaagcctgcgttattaccgaccttgccaatcaagttggcgag
tttaaaaaaggcgatattctaatagcaccttttactgatgcttcatggacccctttattt
gcactagcaagcgccgtggtaaccgacattggttcaatgctttctcacagctctattgtg
gcgcgtgaatttggtattccctgcgttgtaaataccaatcatgcaagcgctttaattaag
acgggcgaccacatcattgtagatgccgaaacaggcctaataacattaaaaaaggacgac
taa

DBGET integrated database retrieval system