Pseudoalteromonas sp. NC201: PNC201_03200 Help Entry PNC201_03200      CDS       T05464                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism psen  Pseudoalteromonas sp. NC201 Pathway psen02024   Quorum sensing psen03018   RNA degradation Brite KEGG Orthology (KO) [BR:psen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PNC201_03200 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PNC201_03200 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psen03019]     PNC201_03200 (hfq)    03036 Chromosome and associated proteins [BR:psen03036]     PNC201_03200 (hfq) Messenger RNA biogenesis [BR:psen03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PNC201_03200 (hfq) Chromosome and associated proteins [BR:psen03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PNC201_03200 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AUJ68976 LinkDB All DBs Position 743441..743704 Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNVLRRERIPVSIFLVNGIKLQGKIQSFDQFVILLENTVNQMVYKHAIS TVVPARAVNFQNATGSEAGDQGEEGNY NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggccaatctttacaagacccatttttgaatgtcttgcgtcgtgagcgcatt cctgtctcaatttttttagtgaatggcattaaattacagggcaagatccagtcatttgac caatttgtgattttgcttgaaaacacagtaaaccaaatggtttacaaacacgccatctcc actgtggttccagctcgtgcggttaacttccaaaatgcaaccggaagtgaagcgggcgac caaggtgaagaaggtaattattaa

DBGET integrated database retrieval system