Pseudomonas sp. TCU-HL1: THL1_5210 Help Entry THL1_5210         CDS       T05373                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pset  Pseudomonas sp. TCU-HL1 Pathway pset02024   Quorum sensing pset03018   RNA degradation Brite KEGG Orthology (KO) [BR:pset00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     THL1_5210  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     THL1_5210  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pset03019]     THL1_5210    03036 Chromosome and associated proteins [BR:pset03036]     THL1_5210 Messenger RNA biogenesis [BR:pset03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      THL1_5210 Chromosome and associated proteins [BR:pset03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     THL1_5210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AOE87757 LinkDB All DBs Position complement(5637422..5637676) Genome browser AA seq 84 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSASEQEQPEPGNT NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctcaataccctgcgtaaggaacgcgta ccggtttccatctatctggtgaacggcatcaagctgcagggccagatcgaatccttcgac cagttcgtgattctgctgaagaacactgtcagccagatggtctacaagcacgctatctcc actgtggtaccaagtcgtccggtacgcctgcccagcgcttccgagcaggagcagcctgag ccgggtaacacctga

DBGET integrated database retrieval system