KEGG   Pseudomonas aeruginosa B136-33: G655_20305
Entry
G655_20305        CDS       T02627                                 
Name
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase III
  KO
K18003  anthraniloyl-CoA anthraniloyltransferase [EC:2.3.1.262]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00405  Phenazine biosynthesis
psg01110  Biosynthesis of secondary metabolites
psg02024  Quorum sensing
psg02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    G655_20305
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G655_20305
   02025 Biofilm formation - Pseudomonas aeruginosa
    G655_20305
Enzymes [BR:psg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.262  anthraniloyl-CoA anthraniloyltransferase
     G655_20305
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N SpoVAD
Other DBs
NCBI-ProteinID: AGI82976
LinkDB
Position
complement(4461157..4462170)
AA seq 337 aa
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLDDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLVAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggtaatccgatcctggccgggctgggtttcagcctgccgaaacgccaggtcagcaat
catgacctggtagggcgcatcaatacgtcggacgagttcatcgtcgaacgtaccggcgtg
cgcacccgctatcacgtcgagccggaacaggcggtcagcgcgctgatggtgccggcggcg
cgccaggccatcgaggctgccgggctgctgccggaggacatcgacctgttgctggtgaac
accctgtcgccggaccaccacgacccgtcccaggcctgcctgatccagccgctgctgggc
ctgcggcacatcccggtactggatatccgggcacagtgcagcgggttgctgtacggcttg
cagatggctcgcgggcagatcctcgccgggctggcacggcatgtcctggtggtctgcggc
gaggtgctgtccaagcgcatggactgttcggaccgcggccgcaacctgtcgatcctgctc
ggcgacggtgccggcgcagtggtggtcagcgccggcgagagcctcgacgacggcctgctg
gacctgcgcctgggcgccgacggcaactacttcgacctgctgatgactgcggcgccgggc
agtgcctcgccgaccttcctcgacgagaacgtcctgcgcgagggcgggggcgagttcctc
atgcgcggccggccgatgttcgagcatgccagccagaccctggtacggatcgccggcgaa
atgctcgtggcccatgagctgaccttggacgacatcgaccatgtgatctgccatcaaccg
aacctgcgcatcctcgatgcggtgcaggagcaactgggcattccccagcacaagttcgcg
gtgaccgtggatcgtctgggcaacatggcttcggcctcgaccccggtcacgctggcgatg
ttctggccggacatccagcccggacagcgggtgctggtcctgacctacggttccggcgcg
acctggggcgcggcgctgtaccgtaaacctgaggaggtgaaccggccatgttga

DBGET integrated database retrieval system