Pseudomonas sp. HS6: JJN09_15850 Help Entry JJN09_15850       CDS       T09971                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pshs  Pseudomonas sp. HS6 Pathway pshs02024   Quorum sensing pshs03018   RNA degradation Brite KEGG Orthology (KO) [BR:pshs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     JJN09_15850 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     JJN09_15850 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pshs03019]     JJN09_15850 (hfq)    03036 Chromosome and associated proteins [BR:pshs03036]     JJN09_15850 (hfq) Messenger RNA biogenesis [BR:pshs03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      JJN09_15850 (hfq) Chromosome and associated proteins [BR:pshs03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     JJN09_15850 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UQS12705 LinkDB All DBs Position complement(3507186..3507446) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSATESEAGDAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaatactttacgtaaagagaaagtt ggggtttccatctacctggtcaacggtatcaaactgcaaggtacgatcgagtcgttcgac cagttcgttatcctgctgaagaacaccgtcagccagatggtttacaaacacgctatctct acagtcgtgccggttcgtccaattcgtctgccaagcgcaaccgaatccgaagcaggtgac gctgagccaggtaacgcctga

DBGET integrated database retrieval system