Pseudomonas siliginis: NF676_03300 Help Entry NF676_03300       CDS       T08569                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism psii  Pseudomonas siliginis Pathway psii02024   Quorum sensing psii03018   RNA degradation Brite KEGG Orthology (KO) [BR:psii00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NF676_03300 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NF676_03300 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psii03019]     NF676_03300 (hfq)    03036 Chromosome and associated proteins [BR:psii03036]     NF676_03300 (hfq) Messenger RNA biogenesis [BR:psii03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NF676_03300 (hfq) Chromosome and associated proteins [BR:psii03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NF676_03300 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UST80363 LinkDB All DBs Position 625625..625891 Genome browser AA seq 88 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSATENEQGDADAAPGNA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaacactttacgtaaagagaaagtc ggggtttccatctatctggtcaacggtatcaagctgcaagggacgatcgagtcgttcgac cagttcgtgatcctgctgaaaaacaccgtaagccagatggtctacaaacacgctatctcg accgtcgtgccggttcgtccaattcgtctgcctagcgcaaccgaaaacgaacagggcgat gccgatgcagcgccgggtaacgcctga

DBGET integrated database retrieval system