KEGG   Phocoena sinus (vaquita): 116738910
Entry
116738910         CDS       T07759                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
psiu  Phocoena sinus (vaquita)
Pathway
psiu01521  EGFR tyrosine kinase inhibitor resistance
psiu01522  Endocrine resistance
psiu01524  Platinum drug resistance
psiu04010  MAPK signaling pathway
psiu04012  ErbB signaling pathway
psiu04014  Ras signaling pathway
psiu04015  Rap1 signaling pathway
psiu04022  cGMP-PKG signaling pathway
psiu04024  cAMP signaling pathway
psiu04062  Chemokine signaling pathway
psiu04066  HIF-1 signaling pathway
psiu04068  FoxO signaling pathway
psiu04071  Sphingolipid signaling pathway
psiu04072  Phospholipase D signaling pathway
psiu04114  Oocyte meiosis
psiu04140  Autophagy - animal
psiu04148  Efferocytosis
psiu04150  mTOR signaling pathway
psiu04151  PI3K-Akt signaling pathway
psiu04210  Apoptosis
psiu04218  Cellular senescence
psiu04261  Adrenergic signaling in cardiomyocytes
psiu04270  Vascular smooth muscle contraction
psiu04350  TGF-beta signaling pathway
psiu04360  Axon guidance
psiu04370  VEGF signaling pathway
psiu04371  Apelin signaling pathway
psiu04380  Osteoclast differentiation
psiu04510  Focal adhesion
psiu04517  IgSF CAM signaling
psiu04520  Adherens junction
psiu04540  Gap junction
psiu04550  Signaling pathways regulating pluripotency of stem cells
psiu04611  Platelet activation
psiu04613  Neutrophil extracellular trap formation
psiu04620  Toll-like receptor signaling pathway
psiu04621  NOD-like receptor signaling pathway
psiu04625  C-type lectin receptor signaling pathway
psiu04650  Natural killer cell mediated cytotoxicity
psiu04657  IL-17 signaling pathway
psiu04658  Th1 and Th2 cell differentiation
psiu04659  Th17 cell differentiation
psiu04660  T cell receptor signaling pathway
psiu04662  B cell receptor signaling pathway
psiu04664  Fc epsilon RI signaling pathway
psiu04666  Fc gamma R-mediated phagocytosis
psiu04668  TNF signaling pathway
psiu04713  Circadian entrainment
psiu04720  Long-term potentiation
psiu04722  Neurotrophin signaling pathway
psiu04723  Retrograde endocannabinoid signaling
psiu04724  Glutamatergic synapse
psiu04725  Cholinergic synapse
psiu04726  Serotonergic synapse
psiu04730  Long-term depression
psiu04810  Regulation of actin cytoskeleton
psiu04910  Insulin signaling pathway
psiu04912  GnRH signaling pathway
psiu04914  Progesterone-mediated oocyte maturation
psiu04915  Estrogen signaling pathway
psiu04916  Melanogenesis
psiu04917  Prolactin signaling pathway
psiu04919  Thyroid hormone signaling pathway
psiu04921  Oxytocin signaling pathway
psiu04926  Relaxin signaling pathway
psiu04928  Parathyroid hormone synthesis, secretion and action
psiu04929  GnRH secretion
psiu04930  Type II diabetes mellitus
psiu04933  AGE-RAGE signaling pathway in diabetic complications
psiu04934  Cushing syndrome
psiu04935  Growth hormone synthesis, secretion and action
psiu04960  Aldosterone-regulated sodium reabsorption
psiu05010  Alzheimer disease
psiu05020  Prion disease
psiu05022  Pathways of neurodegeneration - multiple diseases
psiu05034  Alcoholism
psiu05132  Salmonella infection
psiu05133  Pertussis
psiu05135  Yersinia infection
psiu05140  Leishmaniasis
psiu05142  Chagas disease
psiu05145  Toxoplasmosis
psiu05152  Tuberculosis
psiu05160  Hepatitis C
psiu05161  Hepatitis B
psiu05163  Human cytomegalovirus infection
psiu05164  Influenza A
psiu05165  Human papillomavirus infection
psiu05166  Human T-cell leukemia virus 1 infection
psiu05167  Kaposi sarcoma-associated herpesvirus infection
psiu05170  Human immunodeficiency virus 1 infection
psiu05171  Coronavirus disease - COVID-19
psiu05200  Pathways in cancer
psiu05203  Viral carcinogenesis
psiu05205  Proteoglycans in cancer
psiu05206  MicroRNAs in cancer
psiu05207  Chemical carcinogenesis - receptor activation
psiu05208  Chemical carcinogenesis - reactive oxygen species
psiu05210  Colorectal cancer
psiu05211  Renal cell carcinoma
psiu05212  Pancreatic cancer
psiu05213  Endometrial cancer
psiu05214  Glioma
psiu05215  Prostate cancer
psiu05216  Thyroid cancer
psiu05218  Melanoma
psiu05219  Bladder cancer
psiu05220  Chronic myeloid leukemia
psiu05221  Acute myeloid leukemia
psiu05223  Non-small cell lung cancer
psiu05224  Breast cancer
psiu05225  Hepatocellular carcinoma
psiu05226  Gastric cancer
psiu05230  Central carbon metabolism in cancer
psiu05231  Choline metabolism in cancer
psiu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
psiu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:psiu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116738910 (MAPK1)
   04012 ErbB signaling pathway
    116738910 (MAPK1)
   04014 Ras signaling pathway
    116738910 (MAPK1)
   04015 Rap1 signaling pathway
    116738910 (MAPK1)
   04350 TGF-beta signaling pathway
    116738910 (MAPK1)
   04370 VEGF signaling pathway
    116738910 (MAPK1)
   04371 Apelin signaling pathway
    116738910 (MAPK1)
   04668 TNF signaling pathway
    116738910 (MAPK1)
   04066 HIF-1 signaling pathway
    116738910 (MAPK1)
   04068 FoxO signaling pathway
    116738910 (MAPK1)
   04072 Phospholipase D signaling pathway
    116738910 (MAPK1)
   04071 Sphingolipid signaling pathway
    116738910 (MAPK1)
   04024 cAMP signaling pathway
    116738910 (MAPK1)
   04022 cGMP-PKG signaling pathway
    116738910 (MAPK1)
   04151 PI3K-Akt signaling pathway
    116738910 (MAPK1)
   04150 mTOR signaling pathway
    116738910 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    116738910 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116738910 (MAPK1)
   04148 Efferocytosis
    116738910 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    116738910 (MAPK1)
   04210 Apoptosis
    116738910 (MAPK1)
   04218 Cellular senescence
    116738910 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116738910 (MAPK1)
   04520 Adherens junction
    116738910 (MAPK1)
   04540 Gap junction
    116738910 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    116738910 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116738910 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    116738910 (MAPK1)
   04613 Neutrophil extracellular trap formation
    116738910 (MAPK1)
   04620 Toll-like receptor signaling pathway
    116738910 (MAPK1)
   04621 NOD-like receptor signaling pathway
    116738910 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    116738910 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    116738910 (MAPK1)
   04660 T cell receptor signaling pathway
    116738910 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    116738910 (MAPK1)
   04659 Th17 cell differentiation
    116738910 (MAPK1)
   04657 IL-17 signaling pathway
    116738910 (MAPK1)
   04662 B cell receptor signaling pathway
    116738910 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    116738910 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    116738910 (MAPK1)
   04062 Chemokine signaling pathway
    116738910 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116738910 (MAPK1)
   04929 GnRH secretion
    116738910 (MAPK1)
   04912 GnRH signaling pathway
    116738910 (MAPK1)
   04915 Estrogen signaling pathway
    116738910 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    116738910 (MAPK1)
   04917 Prolactin signaling pathway
    116738910 (MAPK1)
   04921 Oxytocin signaling pathway
    116738910 (MAPK1)
   04926 Relaxin signaling pathway
    116738910 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    116738910 (MAPK1)
   04919 Thyroid hormone signaling pathway
    116738910 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    116738910 (MAPK1)
   04916 Melanogenesis
    116738910 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    116738910 (MAPK1)
   04270 Vascular smooth muscle contraction
    116738910 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    116738910 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    116738910 (MAPK1)
   04725 Cholinergic synapse
    116738910 (MAPK1)
   04726 Serotonergic synapse
    116738910 (MAPK1)
   04720 Long-term potentiation
    116738910 (MAPK1)
   04730 Long-term depression
    116738910 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    116738910 (MAPK1)
   04722 Neurotrophin signaling pathway
    116738910 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    116738910 (MAPK1)
   04380 Osteoclast differentiation
    116738910 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    116738910 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116738910 (MAPK1)
   05206 MicroRNAs in cancer
    116738910 (MAPK1)
   05205 Proteoglycans in cancer
    116738910 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    116738910 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    116738910 (MAPK1)
   05203 Viral carcinogenesis
    116738910 (MAPK1)
   05230 Central carbon metabolism in cancer
    116738910 (MAPK1)
   05231 Choline metabolism in cancer
    116738910 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116738910 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116738910 (MAPK1)
   05212 Pancreatic cancer
    116738910 (MAPK1)
   05225 Hepatocellular carcinoma
    116738910 (MAPK1)
   05226 Gastric cancer
    116738910 (MAPK1)
   05214 Glioma
    116738910 (MAPK1)
   05216 Thyroid cancer
    116738910 (MAPK1)
   05221 Acute myeloid leukemia
    116738910 (MAPK1)
   05220 Chronic myeloid leukemia
    116738910 (MAPK1)
   05218 Melanoma
    116738910 (MAPK1)
   05211 Renal cell carcinoma
    116738910 (MAPK1)
   05219 Bladder cancer
    116738910 (MAPK1)
   05215 Prostate cancer
    116738910 (MAPK1)
   05213 Endometrial cancer
    116738910 (MAPK1)
   05224 Breast cancer
    116738910 (MAPK1)
   05223 Non-small cell lung cancer
    116738910 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116738910 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    116738910 (MAPK1)
   05161 Hepatitis B
    116738910 (MAPK1)
   05160 Hepatitis C
    116738910 (MAPK1)
   05171 Coronavirus disease - COVID-19
    116738910 (MAPK1)
   05164 Influenza A
    116738910 (MAPK1)
   05163 Human cytomegalovirus infection
    116738910 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116738910 (MAPK1)
   05165 Human papillomavirus infection
    116738910 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116738910 (MAPK1)
   05135 Yersinia infection
    116738910 (MAPK1)
   05133 Pertussis
    116738910 (MAPK1)
   05152 Tuberculosis
    116738910 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    116738910 (MAPK1)
   05140 Leishmaniasis
    116738910 (MAPK1)
   05142 Chagas disease
    116738910 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116738910 (MAPK1)
   05020 Prion disease
    116738910 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    116738910 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    116738910 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116738910 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    116738910 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    116738910 (MAPK1)
   04934 Cushing syndrome
    116738910 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116738910 (MAPK1)
   01524 Platinum drug resistance
    116738910 (MAPK1)
   01522 Endocrine resistance
    116738910 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psiu01001]
    116738910 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psiu03036]
    116738910 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psiu04147]
    116738910 (MAPK1)
Enzymes [BR:psiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     116738910 (MAPK1)
Protein kinases [BR:psiu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   116738910 (MAPK1)
Chromosome and associated proteins [BR:psiu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     116738910 (MAPK1)
Exosome [BR:psiu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116738910 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 116738910
NCBI-ProteinID: XP_032458718
Ensembl: ENSPSNG00000013290
UniProt: A0A8C9C1K4
LinkDB
Position
14:complement(63747286..63842092)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggccccgagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcttacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccattgagcagatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccatgatcac
acagggttcctgacggagtacgttgccacacgttggtacagggctccggaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcatcctggcagag
atgctctccaacaggcccatcttcccgggaaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccatcccaggaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccgcacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaagatgttgacgttcaaccctcataag
aggattgaggtggaacaggctctggcccacccgtacctggagcagtactacgacccaagt
gacgagcccatcgccgaagcaccattcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagaccgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system