Phocoena sinus (vaquita): 116740315 Help Entry 116740315         CDS       T07759                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04510   Focal adhesion psiu04520   Adherens junction psiu04670   Leukocyte transendothelial migration psiu04810   Regulation of actin cytoskeleton psiu04814   Motor proteins psiu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psiu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     116740315 (MYL10)    04520 Adherens junction     116740315 (MYL10)   09142 Cell motility    04814 Motor proteins     116740315 (MYL10)    04810 Regulation of actin cytoskeleton     116740315 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     116740315 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116740315 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:psiu04812]     116740315 (MYL10) Cytoskeleton proteins [BR:psiu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      116740315 (MYL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  116740315 NCBI-ProteinID:  XP_032461719 Ensembl:  ENSPSNG00000006913 LinkDB All DBs Position 15:80615509..80624512 Genome browser AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFNVFDTEGKGFVKADFIKEKLMTQADRFSEDEIKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagatccaggagtttaaagaggctttcaccatcatggaccagaac cgggatggcttcatcgacaaggaggacctgagggacacctttgctgccctgggccgcatc aatgtaaagaacgaggagctggaggccatggtgaaggaggcccccgggcccatcaacttc accgtcttcctgaccatgtttggggagaagctgaagggtacggacccagaggagaccatt ctccacgccttcaatgtgttcgacactgaagggaaaggtttcgtcaaggctgatttcatc aaagagaagctcatgacgcaggcagaccgcttcagtgaggacgagatcaagcagatgttt gctgccttcccgccagatgtgtgtggcaatctggactataggaacctgtgttacgtcatc acgcatggcgaagagaaggactaa

DBGET integrated database retrieval system