Phocoena sinus (vaquita): 116740728 Help Entry 116740728         CDS       T07759                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism psiu  Phocoena sinus (vaquita) Pathway psiu04080   Neuroactive ligand-receptor interaction psiu04081   Hormone signaling psiu04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     116740728 (GHRH)    04081 Hormone signaling     116740728 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     116740728 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116740728 (GHRH) Cytokines and neuropeptides [BR:psiu04052]  Neuropeptides   GPCR binding    116740728 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  116740728 NCBI-ProteinID:  XP_032462488 Ensembl:  ENSPSNG00000006249 UniProt:  A0A8C9BUC1 LinkDB All DBs Position 15:22362403..22371105 Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSPPSQPLRMPRYADAIFTNSYRKVLAQLSARKLLQDIMSRQ QGERNQEQGAKVRLGRQVDSMWADQKQMALENILVTLLQEHRTSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccacggctcc ccgccctcccagcccctcaggatgccgaggtacgcagacgccatcttcaccaacagctac cggaaggtgctggcccagctgtctgcccgcaagcttctccaggacatcatgagcaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacagc atgtgggcagaccaaaagcagatggcattggagaacatcctggtgaccctgctgcaggag cacaggacttcccaaggatga

DBGET integrated database retrieval system