Phocoena sinus (vaquita): 116757893 Help Entry 116757893         CDS       T07759                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism psiu  Phocoena sinus (vaquita) Pathway psiu01521   EGFR tyrosine kinase inhibitor resistance psiu01522   Endocrine resistance psiu04010   MAPK signaling pathway psiu04012   ErbB signaling pathway psiu04014   Ras signaling pathway psiu04015   Rap1 signaling pathway psiu04062   Chemokine signaling pathway psiu04068   FoxO signaling pathway psiu04071   Sphingolipid signaling pathway psiu04072   Phospholipase D signaling pathway psiu04137   Mitophagy - animal psiu04140   Autophagy - animal psiu04144   Endocytosis psiu04150   mTOR signaling pathway psiu04151   PI3K-Akt signaling pathway psiu04210   Apoptosis psiu04211   Longevity regulating pathway psiu04213   Longevity regulating pathway - multiple species psiu04218   Cellular senescence psiu04360   Axon guidance psiu04370   VEGF signaling pathway psiu04371   Apelin signaling pathway psiu04510   Focal adhesion psiu04540   Gap junction psiu04550   Signaling pathways regulating pluripotency of stem cells psiu04625   C-type lectin receptor signaling pathway psiu04630   JAK-STAT signaling pathway psiu04650   Natural killer cell mediated cytotoxicity psiu04660   T cell receptor signaling pathway psiu04662   B cell receptor signaling pathway psiu04664   Fc epsilon RI signaling pathway psiu04714   Thermogenesis psiu04720   Long-term potentiation psiu04722   Neurotrophin signaling pathway psiu04725   Cholinergic synapse psiu04726   Serotonergic synapse psiu04730   Long-term depression psiu04810   Regulation of actin cytoskeleton psiu04910   Insulin signaling pathway psiu04912   GnRH signaling pathway psiu04915   Estrogen signaling pathway psiu04916   Melanogenesis psiu04917   Prolactin signaling pathway psiu04919   Thyroid hormone signaling pathway psiu04921   Oxytocin signaling pathway psiu04926   Relaxin signaling pathway psiu04929   GnRH secretion psiu04933   AGE-RAGE signaling pathway in diabetic complications psiu04935   Growth hormone synthesis, secretion and action psiu05010   Alzheimer disease psiu05022   Pathways of neurodegeneration - multiple diseases psiu05034   Alcoholism psiu05132   Salmonella infection psiu05160   Hepatitis C psiu05161   Hepatitis B psiu05163   Human cytomegalovirus infection psiu05165   Human papillomavirus infection psiu05166   Human T-cell leukemia virus 1 infection psiu05167   Kaposi sarcoma-associated herpesvirus infection psiu05170   Human immunodeficiency virus 1 infection psiu05200   Pathways in cancer psiu05203   Viral carcinogenesis psiu05205   Proteoglycans in cancer psiu05206   MicroRNAs in cancer psiu05207   Chemical carcinogenesis - receptor activation psiu05208   Chemical carcinogenesis - reactive oxygen species psiu05210   Colorectal cancer psiu05211   Renal cell carcinoma psiu05213   Endometrial cancer psiu05214   Glioma psiu05215   Prostate cancer psiu05216   Thyroid cancer psiu05218   Melanoma psiu05219   Bladder cancer psiu05220   Chronic myeloid leukemia psiu05221   Acute myeloid leukemia psiu05223   Non-small cell lung cancer psiu05224   Breast cancer psiu05225   Hepatocellular carcinoma psiu05226   Gastric cancer psiu05230   Central carbon metabolism in cancer psiu05231   Choline metabolism in cancer psiu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer psiu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116757893 (HRAS)    04012 ErbB signaling pathway     116757893 (HRAS)    04014 Ras signaling pathway     116757893 (HRAS)    04015 Rap1 signaling pathway     116757893 (HRAS)    04370 VEGF signaling pathway     116757893 (HRAS)    04371 Apelin signaling pathway     116757893 (HRAS)    04630 JAK-STAT signaling pathway     116757893 (HRAS)    04068 FoxO signaling pathway     116757893 (HRAS)    04072 Phospholipase D signaling pathway     116757893 (HRAS)    04071 Sphingolipid signaling pathway     116757893 (HRAS)    04151 PI3K-Akt signaling pathway     116757893 (HRAS)    04150 mTOR signaling pathway     116757893 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116757893 (HRAS)    04140 Autophagy - animal     116757893 (HRAS)    04137 Mitophagy - animal     116757893 (HRAS)   09143 Cell growth and death    04210 Apoptosis     116757893 (HRAS)    04218 Cellular senescence     116757893 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     116757893 (HRAS)    04540 Gap junction     116757893 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     116757893 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116757893 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116757893 (HRAS)    04650 Natural killer cell mediated cytotoxicity     116757893 (HRAS)    04660 T cell receptor signaling pathway     116757893 (HRAS)    04662 B cell receptor signaling pathway     116757893 (HRAS)    04664 Fc epsilon RI signaling pathway     116757893 (HRAS)    04062 Chemokine signaling pathway     116757893 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     116757893 (HRAS)    04929 GnRH secretion     116757893 (HRAS)    04912 GnRH signaling pathway     116757893 (HRAS)    04915 Estrogen signaling pathway     116757893 (HRAS)    04917 Prolactin signaling pathway     116757893 (HRAS)    04921 Oxytocin signaling pathway     116757893 (HRAS)    04926 Relaxin signaling pathway     116757893 (HRAS)    04935 Growth hormone synthesis, secretion and action     116757893 (HRAS)    04919 Thyroid hormone signaling pathway     116757893 (HRAS)    04916 Melanogenesis     116757893 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     116757893 (HRAS)    04726 Serotonergic synapse     116757893 (HRAS)    04720 Long-term potentiation     116757893 (HRAS)    04730 Long-term depression     116757893 (HRAS)    04722 Neurotrophin signaling pathway     116757893 (HRAS)   09158 Development and regeneration    04360 Axon guidance     116757893 (HRAS)   09149 Aging    04211 Longevity regulating pathway     116757893 (HRAS)    04213 Longevity regulating pathway - multiple species     116757893 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     116757893 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116757893 (HRAS)    05206 MicroRNAs in cancer     116757893 (HRAS)    05205 Proteoglycans in cancer     116757893 (HRAS)    05207 Chemical carcinogenesis - receptor activation     116757893 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     116757893 (HRAS)    05203 Viral carcinogenesis     116757893 (HRAS)    05230 Central carbon metabolism in cancer     116757893 (HRAS)    05231 Choline metabolism in cancer     116757893 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116757893 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     116757893 (HRAS)    05225 Hepatocellular carcinoma     116757893 (HRAS)    05226 Gastric cancer     116757893 (HRAS)    05214 Glioma     116757893 (HRAS)    05216 Thyroid cancer     116757893 (HRAS)    05221 Acute myeloid leukemia     116757893 (HRAS)    05220 Chronic myeloid leukemia     116757893 (HRAS)    05218 Melanoma     116757893 (HRAS)    05211 Renal cell carcinoma     116757893 (HRAS)    05219 Bladder cancer     116757893 (HRAS)    05215 Prostate cancer     116757893 (HRAS)    05213 Endometrial cancer     116757893 (HRAS)    05224 Breast cancer     116757893 (HRAS)    05223 Non-small cell lung cancer     116757893 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116757893 (HRAS)    05170 Human immunodeficiency virus 1 infection     116757893 (HRAS)    05161 Hepatitis B     116757893 (HRAS)    05160 Hepatitis C     116757893 (HRAS)    05163 Human cytomegalovirus infection     116757893 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     116757893 (HRAS)    05165 Human papillomavirus infection     116757893 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     116757893 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     116757893 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     116757893 (HRAS)   09165 Substance dependence    05034 Alcoholism     116757893 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116757893 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     116757893 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     116757893 (HRAS)    01522 Endocrine resistance     116757893 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116757893 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116757893 (HRAS)    04031 GTP-binding proteins [BR:psiu04031]     116757893 (HRAS) Membrane trafficking [BR:psiu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     116757893 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     116757893 (HRAS) Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116757893 (HRAS)   Exosomal proteins of colorectal cancer cells    116757893 (HRAS) GTP-binding proteins [BR:psiu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116757893 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin AAA_22 Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  116757893 NCBI-ProteinID:  XP_032496230 Ensembl:  ENSPSNG00000008322 UniProt:  A0A8C9BIV7 LinkDB All DBs Position 8:110105103..110109805 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagcgccctgacc atccagctcatccagaaccactttgtggatgagtacgaccccaccatagaggactcctac cggaagcaagtggtcatcgatggggagacgtgcctgttggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt gtgtttgccatcaacaacgccaagtccttcgaggacatccaccagtacagggagcagatc aaacgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctatacgctggtg cgcgagatccgacagcacaaggcgcgcaagctgagcccgcctgacgagggcggccctggc tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system