KEGG   Phocoena sinus (vaquita): 116757893
Entry
116757893         CDS       T07759                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
psiu  Phocoena sinus (vaquita)
Pathway
psiu01521  EGFR tyrosine kinase inhibitor resistance
psiu01522  Endocrine resistance
psiu04010  MAPK signaling pathway
psiu04012  ErbB signaling pathway
psiu04014  Ras signaling pathway
psiu04015  Rap1 signaling pathway
psiu04062  Chemokine signaling pathway
psiu04068  FoxO signaling pathway
psiu04071  Sphingolipid signaling pathway
psiu04072  Phospholipase D signaling pathway
psiu04137  Mitophagy - animal
psiu04140  Autophagy - animal
psiu04144  Endocytosis
psiu04150  mTOR signaling pathway
psiu04151  PI3K-Akt signaling pathway
psiu04210  Apoptosis
psiu04211  Longevity regulating pathway
psiu04213  Longevity regulating pathway - multiple species
psiu04218  Cellular senescence
psiu04360  Axon guidance
psiu04370  VEGF signaling pathway
psiu04371  Apelin signaling pathway
psiu04510  Focal adhesion
psiu04540  Gap junction
psiu04550  Signaling pathways regulating pluripotency of stem cells
psiu04625  C-type lectin receptor signaling pathway
psiu04630  JAK-STAT signaling pathway
psiu04650  Natural killer cell mediated cytotoxicity
psiu04660  T cell receptor signaling pathway
psiu04662  B cell receptor signaling pathway
psiu04664  Fc epsilon RI signaling pathway
psiu04714  Thermogenesis
psiu04720  Long-term potentiation
psiu04722  Neurotrophin signaling pathway
psiu04725  Cholinergic synapse
psiu04726  Serotonergic synapse
psiu04730  Long-term depression
psiu04810  Regulation of actin cytoskeleton
psiu04910  Insulin signaling pathway
psiu04912  GnRH signaling pathway
psiu04915  Estrogen signaling pathway
psiu04916  Melanogenesis
psiu04917  Prolactin signaling pathway
psiu04919  Thyroid hormone signaling pathway
psiu04921  Oxytocin signaling pathway
psiu04926  Relaxin signaling pathway
psiu04929  GnRH secretion
psiu04933  AGE-RAGE signaling pathway in diabetic complications
psiu04935  Growth hormone synthesis, secretion and action
psiu05010  Alzheimer disease
psiu05022  Pathways of neurodegeneration - multiple diseases
psiu05034  Alcoholism
psiu05132  Salmonella infection
psiu05160  Hepatitis C
psiu05161  Hepatitis B
psiu05163  Human cytomegalovirus infection
psiu05165  Human papillomavirus infection
psiu05166  Human T-cell leukemia virus 1 infection
psiu05167  Kaposi sarcoma-associated herpesvirus infection
psiu05170  Human immunodeficiency virus 1 infection
psiu05200  Pathways in cancer
psiu05203  Viral carcinogenesis
psiu05205  Proteoglycans in cancer
psiu05206  MicroRNAs in cancer
psiu05207  Chemical carcinogenesis - receptor activation
psiu05208  Chemical carcinogenesis - reactive oxygen species
psiu05210  Colorectal cancer
psiu05211  Renal cell carcinoma
psiu05213  Endometrial cancer
psiu05214  Glioma
psiu05215  Prostate cancer
psiu05216  Thyroid cancer
psiu05218  Melanoma
psiu05219  Bladder cancer
psiu05220  Chronic myeloid leukemia
psiu05221  Acute myeloid leukemia
psiu05223  Non-small cell lung cancer
psiu05224  Breast cancer
psiu05225  Hepatocellular carcinoma
psiu05226  Gastric cancer
psiu05230  Central carbon metabolism in cancer
psiu05231  Choline metabolism in cancer
psiu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
psiu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:psiu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116757893 (HRAS)
   04012 ErbB signaling pathway
    116757893 (HRAS)
   04014 Ras signaling pathway
    116757893 (HRAS)
   04015 Rap1 signaling pathway
    116757893 (HRAS)
   04370 VEGF signaling pathway
    116757893 (HRAS)
   04371 Apelin signaling pathway
    116757893 (HRAS)
   04630 JAK-STAT signaling pathway
    116757893 (HRAS)
   04068 FoxO signaling pathway
    116757893 (HRAS)
   04072 Phospholipase D signaling pathway
    116757893 (HRAS)
   04071 Sphingolipid signaling pathway
    116757893 (HRAS)
   04151 PI3K-Akt signaling pathway
    116757893 (HRAS)
   04150 mTOR signaling pathway
    116757893 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116757893 (HRAS)
   04140 Autophagy - animal
    116757893 (HRAS)
   04137 Mitophagy - animal
    116757893 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    116757893 (HRAS)
   04218 Cellular senescence
    116757893 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116757893 (HRAS)
   04540 Gap junction
    116757893 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    116757893 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116757893 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    116757893 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    116757893 (HRAS)
   04660 T cell receptor signaling pathway
    116757893 (HRAS)
   04662 B cell receptor signaling pathway
    116757893 (HRAS)
   04664 Fc epsilon RI signaling pathway
    116757893 (HRAS)
   04062 Chemokine signaling pathway
    116757893 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116757893 (HRAS)
   04929 GnRH secretion
    116757893 (HRAS)
   04912 GnRH signaling pathway
    116757893 (HRAS)
   04915 Estrogen signaling pathway
    116757893 (HRAS)
   04917 Prolactin signaling pathway
    116757893 (HRAS)
   04921 Oxytocin signaling pathway
    116757893 (HRAS)
   04926 Relaxin signaling pathway
    116757893 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    116757893 (HRAS)
   04919 Thyroid hormone signaling pathway
    116757893 (HRAS)
   04916 Melanogenesis
    116757893 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    116757893 (HRAS)
   04726 Serotonergic synapse
    116757893 (HRAS)
   04720 Long-term potentiation
    116757893 (HRAS)
   04730 Long-term depression
    116757893 (HRAS)
   04722 Neurotrophin signaling pathway
    116757893 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    116757893 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    116757893 (HRAS)
   04213 Longevity regulating pathway - multiple species
    116757893 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    116757893 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116757893 (HRAS)
   05206 MicroRNAs in cancer
    116757893 (HRAS)
   05205 Proteoglycans in cancer
    116757893 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    116757893 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    116757893 (HRAS)
   05203 Viral carcinogenesis
    116757893 (HRAS)
   05230 Central carbon metabolism in cancer
    116757893 (HRAS)
   05231 Choline metabolism in cancer
    116757893 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116757893 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116757893 (HRAS)
   05225 Hepatocellular carcinoma
    116757893 (HRAS)
   05226 Gastric cancer
    116757893 (HRAS)
   05214 Glioma
    116757893 (HRAS)
   05216 Thyroid cancer
    116757893 (HRAS)
   05221 Acute myeloid leukemia
    116757893 (HRAS)
   05220 Chronic myeloid leukemia
    116757893 (HRAS)
   05218 Melanoma
    116757893 (HRAS)
   05211 Renal cell carcinoma
    116757893 (HRAS)
   05219 Bladder cancer
    116757893 (HRAS)
   05215 Prostate cancer
    116757893 (HRAS)
   05213 Endometrial cancer
    116757893 (HRAS)
   05224 Breast cancer
    116757893 (HRAS)
   05223 Non-small cell lung cancer
    116757893 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116757893 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    116757893 (HRAS)
   05161 Hepatitis B
    116757893 (HRAS)
   05160 Hepatitis C
    116757893 (HRAS)
   05163 Human cytomegalovirus infection
    116757893 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116757893 (HRAS)
   05165 Human papillomavirus infection
    116757893 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116757893 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116757893 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    116757893 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    116757893 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116757893 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    116757893 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116757893 (HRAS)
   01522 Endocrine resistance
    116757893 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psiu04131]
    116757893 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psiu04147]
    116757893 (HRAS)
   04031 GTP-binding proteins [BR:psiu04031]
    116757893 (HRAS)
Membrane trafficking [BR:psiu04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    116757893 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    116757893 (HRAS)
Exosome [BR:psiu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   116757893 (HRAS)
  Exosomal proteins of colorectal cancer cells
   116757893 (HRAS)
GTP-binding proteins [BR:psiu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    116757893 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin AAA_22 Ldh_1_N AAA_16
Other DBs
NCBI-GeneID: 116757893
NCBI-ProteinID: XP_032496230
Ensembl: ENSPSNG00000008322
UniProt: A0A8C9BIV7
LinkDB
Position
8:110105103..110109805
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagcgccctgacc
atccagctcatccagaaccactttgtggatgagtacgaccccaccatagaggactcctac
cggaagcaagtggtcatcgatggggagacgtgcctgttggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt
gtgtttgccatcaacaacgccaagtccttcgaggacatccaccagtacagggagcagatc
aaacgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc
tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctatacgctggtg
cgcgagatccgacagcacaaggcgcgcaagctgagcccgcctgacgagggcggccctggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system