Pseudomonas solani: PSm6_14600 Help Entry PSm6_14600        CDS       T09213                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism psoa  Pseudomonas solani Pathway psoa02024   Quorum sensing psoa03018   RNA degradation Brite KEGG Orthology (KO) [BR:psoa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PSm6_14600 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PSm6_14600 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psoa03019]     PSm6_14600 (hfq)    03036 Chromosome and associated proteins [BR:psoa03036]     PSm6_14600 (hfq) Messenger RNA biogenesis [BR:psoa03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PSm6_14600 (hfq) Chromosome and associated proteins [BR:psoa03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PSm6_14600 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  BCD85053 UniProt:  A0AAU7Y118 LinkDB All DBs Position complement(1561468..1561722) Genome browser AA seq 84 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSATEQENPEPGNA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaataccttgcgtaaggaacgcgta ccggtttccatctatctggttaacggcatcaagctgcaaggccagatcgaatccttcgac cagttcgtgattttgctgaagaacactgtcagccagatggtctacaagcacgcaatctcc accgtggtaccgagccgccccgtgcgtctgccgagtgccaccgagcaagaaaaccccgag cctggtaacgcctga

DBGET integrated database retrieval system