KEGG   Phytophthora sojae: PHYSODRAFT_471775
Entry
PHYSODRAFT_471775 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
psoj  Phytophthora sojae
Pathway
psoj00790  Folate biosynthesis
psoj01100  Metabolic pathways
psoj01240  Biosynthesis of cofactors
Module
psoj_M00841  Tetrahydrofolate biosynthesis, mediated by PTPS, GTP => THF
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHYSODRAFT_471775
Enzymes [BR:psoj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     PHYSODRAFT_471775
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     PHYSODRAFT_471775
SSDB
Motif
Pfam: PTPS zf-BED PyrI_C zf-CHCC
Other DBs
NCBI-GeneID: 20654145
NCBI-ProteinID: XP_009517256
JGI: Physo3_471775
UniProt: G4YL66
LinkDB
Position
Unknown
AA seq 241 aa
MGKELTAAQKELVKVFVTREVAEGPVKCNYCDKEITSRNVDRWASHLRGCVKTPADIKAQ
IQPHRDGEEAPPAPTSAAGRSVHVSTDYMKFNAAHFIAYKGFREKLHGHNYRLAVTITGQ
VGPDGYVVDFGEIKKISRVICKDLNESFLVPMNSDALKISFDGTNVHILTEDNAKFSFPK
SDCSLLPIVHSSAEELAIYISNQLIDSFTIVALLERGVRKLEVSISEANQQFATYERTIL
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggcaaggaactcaccgcagcgcagaaggagctcgtcaaggtgttcgtgacgcgcgaa
gtggccgagggacccgtcaagtgcaactactgcgacaaggagatcacctcgcgcaacgtc
gaccgctgggcgtcgcacctgcgcggatgcgtcaagacgccggccgacatcaaggcgcag
atccagccgcaccgtgacggggaggaggcgcctcccgctccgaccagcgctgccgggcga
tcggtgcacgtgtccacggactacatgaagttcaacgccgcgcacttcattgcatacaag
gggttccgggagaagctgcacggacacaactaccgcctggccgtcactatcacaggtcag
gttggaccggacggatacgtggttgacttcggtgagatcaagaagatctcgcgcgtcatc
tgcaaggacctgaacgagtcgttcctggtgccgatgaatagtgatgctctgaagatttcg
tttgatggcacgaatgtccacattctcacggaagacaacgccaagttcagcttcccgaaa
tcggactgctcgctgctgccgattgtccactcatcggctgaggagctcgccatttacatc
agcaaccagctcattgactcgtttacgatcgttgcactcttggagcgcggcgtgcggaag
ctggaggtgagcatctcggaggccaaccagcaattcgccacgtacgagcgcactattctt
gcgtaa

DBGET integrated database retrieval system