KEGG   Papaver somniferum (opium poppy): 113322097
Entry
113322097         CDS       T05758                                 
Name
(RefSeq) trifunctional (S)-stylopine synthase/(S)-nandinine synthase/(S)-canadine synthase-like
  KO
K13395  (S)-stylopine/(S)-canadine/(S)-nandinine synthase [EC:1.14.19.64 1.14.19.68 1.14.19.73]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00945  Sanguinarine biosynthesis, (S)-reticuline => sanguinarine
psom_M00946  Noscapine biosynthesis, (S)-reticuline => noscapine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113322097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:psom00199]
    113322097
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.64  (S)-stylopine synthase
     113322097
    1.14.19.68  (S)-canadine synthase
     113322097
    1.14.19.73  (S)-nandinine synthase
     113322097
Cytochrome P450 [BR:psom00199]
 Cytochrome P450, plant type
  CYP719 family
   113322097
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 113322097
NCBI-ProteinID: XP_026425901
LinkDB
Position
11:complement(127975413..127977316)
AA seq 486 aa
MIMSNLWILTLISTILAVFAAVLIIFRRRISASTTEWPVGPKTLPIIGNLHILGGTALHV
VLHKLAEVYGSVMTIWIGSWKPVIIVSDFDRAWEVLVNKSSDYSAREMPEITKIGTANWR
TISSSDSGPFWATLRKGLQSVALSPQHLASQTAHQERDIIKLIKNLKDEAASGMVKPLDH
LKKATVRLISRLIYGQDFDDDKYVEDMHDVIEFLIRISGYAQLAEVFYYAKYLPGHKRAV
TGAEEAKRRVIALVRPFLQSNPATNTYLHFLKSQLYPEEVIIFAIFEAYLLGVDSTSSTT
AWALAFLIREPSVQEKLYQELKNFTANNNRTMLKVEDVNKLPYLQAVVKETMRMKPIAPL
AIPHKACKDTSLMGKKVDKGTKVMVNIHALHHTEKVWKEPYKFIPERFLQKHDKAMEQSL
LPFSAGMRICAGMELGKLQFSFSLANLVNAFKWSCVSDGVLPDMSDLLGFVLFMKTPLEA
RIVPRL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgatcatgagtaacttatggattcttacgctcatttctaccatattagcagtctttgct
gctgtgttaatcattttcaggagaagaatatcagcatccacaacggaatggcctgttggc
ccaaaaacattaccaatcataggtaacttgcacattcttggaggcactgctctccatgtc
gtcttacataaacttgctgaagtttacggcagtgtaatgacgatatggattggtagttgg
aaacctgttattattgtttccgactttgatcgagcctgggaagttcttgttaacaaatcg
tcagattattcagctcgtgaaatgcctgagatcactaaaatcggcactgcaaattggaga
acaatttcaagttctgattctggtccgttttgggccactcttcgaaaaggtcttcagagt
gtagcattatcgcctcagcatttagcatcgcaaactgcacaccaagagagagatataata
aagttgatcaaaaatttgaaagacgaagcagcttctggaatggttaaaccacttgatcat
ctcaagaaagcaactgtaagattaatcagtcggttaatctatggtcaggattttgatgac
gataagtatgttgaagatatgcatgacgtgatcgagtttttgattcgtattagtggttat
gctcaacttgctgaggtattctattatgctaaatatctaccaggtcataagagagctgta
actggcgccgaagaagcaaaaagaagagtaatagctctggtgcgtccttttcttcagtca
aaccctgctactaacacttacttgcattttctcaaatcgcaactgtatcctgaagaggtt
atcatattcgctatattcgaagcttatcttttaggtgttgatagcacttcttcaaccact
gcatgggcactcgcattcttaatacgcgaaccatctgttcaagagaaactttatcaagag
cttaagaatttcacagccaataacaatcgcacaatgctgaaagtcgaagacgtcaacaaa
ttaccatatttacaagctgttgttaaagaaacaatgaggatgaaaccaattgcaccactg
gcgattcctcataaagcttgtaaagacacttcattgatgggcaagaaagttgataaggga
actaaagttatggttaacattcatgctttacatcatactgaaaaggtttggaaagaacct
tacaaattcataccagagaggtttctgcagaagcacgataaggcgatggaacaatcacta
ttaccatttagtgcaggtatgagaatttgtgcaggaatggaattaggaaaacttcagttt
agtttttctcttgctaatcttgttaatgcttttaaatggtcttgtgtgtctgatggagtg
cttcctgatatgagtgatttactggggtttgttctgttcatgaaaaccccactcgaagca
cgtatagttcctcgtttgtag

DBGET integrated database retrieval system