KEGG   Papaver somniferum (opium poppy): 113330723
Entry
113330723         CDS       T05758                                 
Name
(RefSeq) protopine 6-monooxygenase
  KO
K21693  protopine 6-monooxygenase [EC:1.14.14.98]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00945  Sanguinarine biosynthesis, (S)-reticuline => sanguinarine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113330723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:psom00199]
    113330723
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.98  protopine 6-monooxygenase
     113330723
Cytochrome P450 [BR:psom00199]
 Cytochrome P450, plant type
  CYP82 family
   113330723
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 113330723
NCBI-ProteinID: XP_026433336
LinkDB
Position
Unknown
AA seq 541 aa
MDFSSLLLLLLNTWISAYSMAALLALVLVYNLRMTKSSSSKTTSLKGKKIITRPPAVTGA
WPVFGHLHLFGSGEHPHEMLSKLAEKYGPSFTMKFGKHTTLVVSDTRVVKECFTTNDTLF
SNRPSTIAFDLMTYATDSIAFTPYSPYWRELRKISTLKLLSNNRLESIKQLRTSEVSVCF
KELYDLTNKKNDNGAPVPIDLKRWFDEVSNNVIMRVIFGKQNFGSKIVLGEDQEAVHYKK
IMDELSRLSSLTMLSDMVPLLGWLDYFKGDLRAMKRNGKELNSILQKWLEEHKSKKSSDA
RQDFMDVMLSISKDTQLYGHDQDTFIKATCLAMIMGGTNSTEVALTWILSLLMNNRCALH
KAREEIDLLVGKDRQVEDSDVKNLTYMNAIIKETMRLYPLGFLLERDTKEDCEVSGFNIK
GGTRLLINVWKLQRDPNVWTDPMEFKPERFLTENADIDVGGQHFELLPFGAGRRVCPGVS
FALQFMHLVLARLIHGYDMETLNGEDVDLSVSSGGHVNIKSTPLELILAPRLHPELYDCE
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggatttctcatcactactattactacttctaaacacatggatttcagcttattccatg
gctgctcttcttgccttagttcttgtctacaatctcaggatgacgaagtcatcatcttcc
aaaaccacttctctgaagggcaagaagattattactaggccaccagcagtaacaggcgca
tggccggtttttggtcacctgcatttgtttggatcaggtgagcatccacatgagatgttg
tcaaagttggcagaaaaatatggaccttcctttacaatgaagttcgggaagcacacaaca
ctagttgtgagcgatacccgagtcgtcaaagaatgttttacaactaatgataccctcttc
tccaaccgcccatccaccatagctttcgatcttatgacttatgcaaccgactccatagct
ttcactccttatagtccttactggcgtgaactcaggaagatatctactctcaaacttctc
tctaacaaccgtcttgaatcgatcaaacaacttcgaacctcagaggtgagcgtatgcttc
aaggaactatacgacctaaccaacaaaaaaaacgataacggagctccagttccaatcgat
ttgaagagatggtttgatgaggtttcaaacaatgtaattatgagagtaatctttgggaaa
caaaattttggatccaagattgtactcggggaagatcaagaggcagtccattataaaaaa
atcatggacgaactttcacgtctttctagtttgactatgttgtcggacatggttccttta
cttggttggttggattacttcaaaggcgatttgagggcaatgaaacgaaacggcaaagaa
cttaactccatactccagaaatggttggaggaacataaaagcaagaaaagttcagatgct
cgacaagatttcatggatgttatgttgtcaatttccaaggacacccaactctatggccac
gaccaagatacttttattaaagctacttgtcttgccatgatcatgggtggaacaaacagt
acggaagtggctctaacatggatcttgtccttacttatgaacaacagatgcgcattgcat
aaggctcgagaagaaatagacttactcgttgggaaggatagacaagtggaagattcagat
gtcaagaatttgacatacatgaatgccatcattaaagaaacaatgcgattatacccatta
ggttttcttctagaacgcgataccaaggaagactgtgaagttagcgggttcaacatcaaa
ggtggtacaagattactgataaatgtgtggaagttacaacgagacccgaacgtgtggaca
gaccccatggaattcaaaccagagagatttctaacagagaatgcagacatagatgttggt
ggtcaacatttcgaactactgccatttggtgctggtagaagggtgtgtcctggtgtgtcc
ttcgcactacagttcatgcatttggttctcgcccgtcttatccatggctatgatatggaa
accctaaatggtgaagatgttgatttgagtgttagtagcgggggacatgttaacatcaaa
tcaaccccacttgagctcatccttgctcctcgccttcacccagagctttacgattgtgaa
acataa

DBGET integrated database retrieval system