KEGG   Papaver somniferum (opium poppy): 113347790
Entry
113347790         CDS       T05758                                 
Name
(RefSeq) thebaine 6-O-demethylase-like
  KO
K14976  thebaine 6-O-demethylase [EC:1.14.11.31]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00944  Morphine biosynthesis, (S)-reticuline => morphine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113347790
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.31  thebaine 6-O-demethylase
     113347790
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 113347790
NCBI-ProteinID: XP_026447248
LinkDB
Position
2:59955765..59966942
AA seq 364 aa
MEKAKLMKLGNGMEIPSVQELAKLTLAEIPSRYVCTDENLLLPMGASVINDHETIPVIDI
ENLLSPEPIIGKLELDRLHSACKEWGFFQVVNHGVDASLVDSVKSEIQGFFNLSMDEKTK
YEQEDGDVEGFGQGFIASEDQTLDWADIFMMFTLPLHLRKPHLFSKLPVPLRETIESYSS
EMKNLSMVLFNKMEKALQVQAAEIKGMSEVFKDGTQAMRMNYYPPCPQPNLAIGLTSHSD
FGGLTILLQINEVEGLQIKREGTWISVKPLPNAFVVNVGDILEIMTNGIYHSVDHRAVVN
STNERLSIATFHDPSLESVIGPISSLITPETPALFKSGSTYGDLVEECKTRKLDGKSFLD
SMRM
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggagaaagcaaaacttatgaagctaggtaatggtatggaaataccaagtgttcaagaa
ttggctaaactcacgcttgccgaaattccatctcgatacgtatgcaccgatgaaaacctt
ttgttgcctatgggtgcttctgtcataaatgatcatgaaaccattcctgtcatcgatata
gaaaatttattatctccagaacccataatcggaaagttagaattggataggcttcattct
gcttgcaaagaatggggtttttttcaggtagtgaaccatggagtcgacgcttcattggtg
gatagtgtaaaatcagaaattcaaggtttctttaacctttctatggatgagaaaactaaa
tatgaacaggaagatggagatgtggaaggatttggacaaggctttattgcatcagaggac
caaacacttgattgggcagatatatttatgatgttcactcttccactccatttaaggaag
cctcacttattttcaaaactcccagtgcctctcagggagacaatcgaatcctactcatca
gaaatgaaaaacttatccatggttctctttaataagatggaaaaagctctacaagtacaa
gcagccgagattaagggtatgtcagaggtgtttaaagatgggacacaagcaatgaggatg
aactattatcccccttgtcctcaaccaaatctcgccatcggtcttacgtcgcactcggat
tttggcggtttgacaatcctccttcaaatcaacgaagtggaaggattacagataaaaaga
gaggggacatggatttcagtcaaacctctacctaatgcgttcgtagtgaacgttggagat
attttggagataatgactaatggaatttaccatagcgtcgatcaccgggcagtagtaaac
tcaacaaatgagaggctctcaatcgcaacatttcatgaccctagtctagagtcggtaata
ggcccaatatcaagcttgattactccagagacacctgctttgtttaaaagtggatctaca
tatggggatcttgtggaggaatgtaaaacaaggaagctcgatggaaaatcatttcttgac
tccatgaggatgtga

DBGET integrated database retrieval system