Pseudomonas sp. Os17: POS17_1811 Help Entry POS17_1811        CDS       T04177                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psos  Pseudomonas sp. Os17 Pathway psos00998   Biosynthesis of various antibiotics psos01100   Metabolic pathways psos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     POS17_1811 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     POS17_1811 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAQ73505 UniProt:  A0A0D6BF66 LinkDB All DBs Position 1981144..1981380 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaagaa gaagaagttgtgaacaccgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactaccgttcaagcagctatcgactacgttaccagccaccaggcttaa

DBGET integrated database retrieval system