Pseudoalteromonas sp. R3: ELR70_21335 Help Entry ELR70_21335       CDS       T10968                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism psrr  Pseudoalteromonas sp. R3 Pathway psrr02024   Quorum sensing psrr03018   RNA degradation Brite KEGG Orthology (KO) [BR:psrr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ELR70_21335  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ELR70_21335  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psrr03019]     ELR70_21335    03036 Chromosome and associated proteins [BR:psrr03036]     ELR70_21335 Messenger RNA biogenesis [BR:psrr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ELR70_21335 Chromosome and associated proteins [BR:psrr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ELR70_21335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AZZ99396 LinkDB All DBs Position 1:complement(3704429..3704692) Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNVLRRERIPVSIFLVNGIKLQGKIQSFDQFVILLENTVNQMVYKHAIS TVVPARAVNFQNTQGNDSAEHGEDGNF NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggccaatcgttacaagacccatttttgaatgtcttacgtcgtgagcgcatt cccgtttccatctttttagttaacggtatcaaattacaaggcaagatccagtcctttgat cagttcgtcatcttgcttgaaaacacagtaaatcagatggtttacaaacacgccatttcg accgtggtgcctgctcgtgctgtaaatttccagaacacacaaggcaatgacagtgcagaa catggcgaagatggtaacttttaa

DBGET integrated database retrieval system