Pseudoalteromonas sp. R3: ELR70_23450 Help Entry ELR70_23450       CDS       T10968                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism psrr  Pseudoalteromonas sp. R3 Pathway psrr00261   Monobactam biosynthesis psrr01100   Metabolic pathways psrr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psrr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ELR70_23450  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psrr01008]     ELR70_23450 Polyketide biosynthesis proteins [BR:psrr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ELR70_23450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Sin3_corepress Motif Other DBs NCBI-ProteinID:  AZZ99766 LinkDB All DBs Position 1:complement(4199805..4200008) Genome browser AA seq 67 aa AA seqDB search MSFDNENGTFKVLVNHEEQYSLWPSYKSVPGGWKDVGVEGDKETCLAYINEHWTDMRPLS LRQAMEQ NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagctttgacaatgaaaatggcaccttcaaggtattggtcaaccacgaagagcaatat tcactctggcccagctataaaagcgttccgggtggctggaaagacgtgggtgtggaaggt gataaagagacctgtctggcctacatcaatgaacactggaccgatatgcgtccactcagc cttcgccaggcaatggaacagtaa

DBGET integrated database retrieval system