KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445432
Entry
102445432         CDS       T02980                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 102445432
NCBI-ProteinID: XP_006126120
LinkDB
Position
Unknown
AA seq 123 aa
MAIRTNSSEYYLSYEYYWDYLDPVPIDERKLKANKYSIVIAFWVGLAAFVLFLFLILLYM
SRSGSTPVKQVPAGNRIEHLEGGSSNAERLHCHDLSSPDSDLISTEILHSLSDKIGIHGS
ISA
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctatcagaacaaactcatctgagtattatttgtcttatgaatattactgggactat
ttggatccagtacctatagatgaaaggaagttgaaggctaataaatattcaattgtcatc
gccttttgggttggacttgctgcatttgtattgtttctgttccttatattgctctatatg
tctcgatctggttcaacaccagtcaaacaggtgcctgcaggtaacaggatagaacatctg
gaaggaggaagctccaatgctgagcggctgcattgtcatgatctcagcagtccggactca
gacttgatctctactgaaatactccattccctttcagataaaattggcattcatggaagt
atctctgcttga

DBGET integrated database retrieval system