KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102450792
Entry
102450792         CDS       T02980                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102450792 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pss04050]
    102450792 (TNFRSF8)
   04090 CD molecules [BR:pss04090]
    102450792 (TNFRSF8)
Cytokine receptors [BR:pss04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102450792 (TNFRSF8)
CD molecules [BR:pss04090]
 Proteins
  102450792 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 DUF6480
Other DBs
NCBI-GeneID: 102450792
NCBI-ProteinID: XP_025042920
Ensembl: ENSPSIG00000009876
LinkDB
Position
Unknown
AA seq 498 aa
MLITSARSCDVLNNWFYDETLKSCCYRCPSDDHKRKACPTDPRRDCSQCEPEYFLNREHK
RPRCDACVSCKPEYDLVEKVPCSSDTSRVCECRAGMFCKVAVLNSCARCVSHTVCQPGFG
VLVRGTSKVDVSCEECSWGTFSDQYSSTEPCKPHTDCAKLNKIAVGSGNATHDQICVDPS
PTPLAPTTWSAKSSREPALSNMAKAPLPSEQPTVGGWGPHPATEPMTQASMLMSDMASGD
ANSTAGGTVGGTDTKHAAGTPPASDIALEKTTKKGDGSFVLWGVVILCMVVLFAGMLVVW
QRKVCKRWIFTPDGKTPGLYPVTTCRLSSAHQGSDLMKNCAKRFSMLKADKESEERAEER
VLINRTPVVETNNNLVSRTEKNPSPDSSLTDLIQSTGNTTDHPADSRVRDHTNNRIDKIY
IMKADTVIVGSISEVPVSKNCAIRGCDYDAEAQENLEDKELAIHYPQQETESFPGSDVTI
PVEEEGKEFHHPTTATEK
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgttgattacctcagcccgctcctgtgatgtgctaaataactggttctatgatgaaact
ttaaaaagctgctgctaccgatgtccctcagatgaccataaaaggaaagcgtgtcccaca
gatccacgcagggactgcagccaatgtgagcccgagtacttcctgaacagggagcacaag
aggcctcgctgcgatgcgtgtgtgtcgtgcaaaccagaatacgaccttgtggagaaggta
ccttgctcctctgataccagcagggtgtgcgagtgccgagcggggatgttctgtaaggtg
gccgttctcaacagctgtgcacgatgcgtgtcccacacggtctgccagccaggatttgga
gtcctagttagaggcacctcgaaagttgatgtctcctgtgaggaatgctcttggggtacc
ttctctgatcagtactccagcaccgagccctgcaagccccacacagactgtgccaagcta
aacaagatcgcagtgggcagcggaaacgccacacacgaccaaatctgcgtggacccgtct
ccgacccccctcgcccccaccacgtggtctgcgaaatccagccgcgagccagcgctttcc
aatatggcaaaagcaccgctcccgagcgagcagcccacagtgggaggctggggtccccac
cctgccacagagcccatgacccaggccagtatgctcatgagtgacatggcctctggcgac
gccaactcgactgctgggggaactgtggggggaacggataccaaacacgcagctggcact
cccccggcctcggatatcgctttagaaaagacgaccaagaaaggtgatgggagctttgtt
ctctggggagtggtgattctctgcatggttgtgctgttcgctggtatgctggtggtttgg
caaaggaaggtttgcaagaggtggatcttcaccccagatggaaagactcctggtctgtat
ccagtcactacatgtagactcagttcggcacatcaaggttctgatctgatgaagaactgc
gcaaaaaggttcagtatgctgaaagctgacaaagagtcagaagagagggcagaagagagg
gtgttaataaacagaacccctgtggtagaaaccaacaacaacttggtctcccgcacagaa
aaaaatcccagtcctgactcaagtctgactgacctgatccagagcacagggaacaccaca
gaccaccctgctgattcccgcgtgagagaccacactaataaccgaatcgataaaatatac
atcatgaaagccgacactgtgattgtgggatccatttcagaagtgcctgtcagcaagaat
tgtgctattagaggatgtgactatgatgccgaagcccaagagaacctggaggataaagaa
cttgcaatacactatccgcagcaggagactgaatcctttccaggaagtgatgtaacgatt
ccggtggaggaggagggcaaggaattccatcaccctaccacggccactgagaagtga

DBGET integrated database retrieval system