Paracoccus stylophorae: JHW45_14885 Help Entry JHW45_14885       CDS       T08951                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pstl  Paracoccus stylophorae Pathway pstl02024   Quorum sensing pstl03018   RNA degradation Brite KEGG Orthology (KO) [BR:pstl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     JHW45_14885 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     JHW45_14885 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pstl03019]     JHW45_14885 (hfq)    03036 Chromosome and associated proteins [BR:pstl03036]     JHW45_14885 (hfq) Messenger RNA biogenesis [BR:pstl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      JHW45_14885 (hfq) Chromosome and associated proteins [BR:pstl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     JHW45_14885 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  WCR10331 UniProt:  A0ABY7STW4 LinkDB All DBs Position complement(3033026..3033259) Genome browser AA seq 77 aa AA seqDB search MAGDRQNLQDAFLNHVRKAKVPVTIFLINGVKLQGVITWFDNFCVLLRRDGQSQLVYKHA ISTIMPGQPINLHEGED NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccggtgacagacaaaacctgcaggacgcgttcctgaaccatgtccgcaaggcgaag gtgccggtgacgatctttctgatcaacggggtcaagctgcagggcgtcatcacctggttc gacaatttctgcgtgctgctgcgccgcgacgggcagtcccagcttgtctacaagcacgcg atcagcaccatcatgcccggccagccgatcaacctgcacgaaggcgaggactga

DBGET integrated database retrieval system