KEGG   Pseudarthrobacter sulfonivorans: AU252_00410
Entry
AU252_00410       CDS       T04210                                 
Name
(GenBank) 2,3-dihydroxybenzoate-AMP ligase
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul01100  Metabolic pathways
psul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    AU252_00410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:psul01008]
    AU252_00410
Enzymes [BR:psul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     AU252_00410
Polyketide biosynthesis proteins [BR:psul01008]
 Polyketide tailoring proteins
  Others
   AU252_00410
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ALV39812
UniProt: A0A0U3QHP6
LinkDB
Position
96168..97841
AA seq 557 aa
MTSHTSEGTTPWPADLAAEFRAKGYWEDRALGSYILETADRLPHKIAIVDGDVRLTYAEL
ANRMDAAAERLLQLGLKADDRIMVQLPNGWQFALLTLACFRAGIIPVMALPAHRQYELSF
LTELSESRAIAVPDVIKDFDHQAMAEELAASIPALEIILVSGTAKPLNVRLEEILAPLKD
VSATRARLDAAAPSPDSPALFLLSGGTTGLPKLITRTHNDYAYNIKACSIPTAVTEDTVY
LGTLPASHNFPLACPGILGILFAGGRVIMLPSPEPRKAFAAIEREGVTLSTAVPAVAQRW
IEYQQETGSSQLATLEVLQVGGSRLPDEIARKVKPVLGATLQQVFGMAEGLINTTRLNDP
EDVICTTQGRPVSEADEVRIVDESGKDLPDGVPGSILTRGPYTPRGYYRAPEANARAFTP
DGWYASGDIVERRPDGNLIVQGRDKDMINRGGEKISAEEIESLVYRIEDVTMAAAIAMPD
QVLGERLCLYITVKPGTEVTLEQIQDLLRRTGVAAFKIPEHLVVVDELPTTKVGKINKKD
LRADIAERLAAAGSQGK
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgacaagccacaccagcgaaggcaccaccccctggccagccgacctggccgcggagttc
cgcgccaaaggctactgggaggaccgcgccctgggcagctacatcctcgaaacagccgac
cggttgcctcacaagatcgcaatcgtcgacggtgacgtgcggctcacatacgccgaactt
gccaacagaatggatgccgccgccgaacgcctcctccagttggggctgaaagcggacgac
cgcatcatggtccagctgcccaacggctggcagttcgcgctgctgaccctggcatgcttc
cgcgccggcatcatcccggtcatggcgctgccggcacaccggcaatacgaactgtccttc
ctgacggaactctctgagtcccgggccatcgccgtcccggatgtcatcaaggactttgat
caccaggccatggccgaagaacttgcggcatccattcctgctctggagatcatcctcgtt
tccggtacggcgaagccactcaacgtacggctcgaggagattttggcaccactaaaggac
gtctcggctacccgggcacggctggacgccgccgctccttcaccggactcacccgcactg
ttcctgctctccggcggcaccaccggcctgcccaagctcatcaccaggacccacaacgac
tacgcctacaacatcaaggcctgctccatccccaccgccgtcaccgaggacaccgtttac
ctcgggacccttcccgccagccacaacttcccgctggcctgccccggaatcctcggcatc
ctgttcgccggcggccgagtgataatgctgccaagccccgaaccacgcaaagccttcgcc
gcaatcgaacgtgagggagtgacactttcgaccgcagtcccggccgtggcccagcggtgg
atcgaataccagcaggaaaccggcagcagccagctcgccaccctcgaggtcctccaggtg
ggcggctcccggctgccggacgaaatcgcccggaaggtcaagcccgtcctaggcgccacg
ctgcagcaggtgttcggcatggccgagggactcatcaacaccacccggctgaacgacccc
gaagacgtcatctgcaccacacagggccgccccgtctccgaagccgacgaagtccggatt
gtggacgagtccggtaaggacctccccgacggtgtccccggatccatcctgacccgcggt
ccctataccccacgcggctattaccgcgcgcccgaagcgaacgcccgtgccttcaccccg
gacggctggtacgccagcggggacatcgtagagcgccgccccgacggaaacctgattgtc
cagggacgcgacaaggacatgatcaaccgaggcggcgaaaagatctccgccgaagagatc
gaaagcctggtctaccggatcgaagacgtcaccatggcggctgcgatcgcgatgccggac
caggtcctcggggaacggctctgcctctacatcacggtcaaacccgggaccgaagtcacc
ctcgaacagatccaggacctgctgcgccgcaccggcgtggcagccttcaaaatccctgaa
catctcgtcgtcgtagacgaactacccaccaccaaagtgggaaaaatcaacaaaaaggac
ctccgcgccgacatcgccgaacgcctggcggctgccggctcccaaggaaagtag

DBGET integrated database retrieval system