Pseudomonas sp. VLB120: PVLB_02725 Help Entry PVLB_02725        CDS       T02897                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism psv  Pseudomonas sp. VLB120 Pathway psv02024   Quorum sensing psv03018   RNA degradation Brite KEGG Orthology (KO) [BR:psv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PVLB_02725 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PVLB_02725 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psv03019]     PVLB_02725 (hfq)    03036 Chromosome and associated proteins [BR:psv03036]     PVLB_02725 (hfq) Messenger RNA biogenesis [BR:psv03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PVLB_02725 (hfq) Chromosome and associated proteins [BR:psv03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PVLB_02725 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AGZ33354 LinkDB All DBs Position 628270..628530 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAIS TVVPARPVRLPSPSDSEHGDSEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaacaccttgagaaaagaaaaggtc ccggtttccatctacctggtaaacggtatcaagctgcagggctcgatcgaatctttcgac cagttcgtggtactgctgaagaacaccgtcagccagatggtctacaagcacgccatttcg accgtggttccagcccgtccggttcgcctgccaagcccgtccgattccgaacacggcgac agcgagccaggcaacgcctga

DBGET integrated database retrieval system