Pseudomonas taetrolens: NCTC10697_04072 Help Entry NCTC10697_04072   CDS       T08085                                  Symbol hfq Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism ptae  Pseudomonas taetrolens Pathway ptae02024   Quorum sensing ptae03018   RNA degradation Brite KEGG Orthology (KO) [BR:ptae00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NCTC10697_04072 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NCTC10697_04072 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptae03019]     NCTC10697_04072 (hfq)    03036 Chromosome and associated proteins [BR:ptae03036]     NCTC10697_04072 (hfq) Messenger RNA biogenesis [BR:ptae03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NCTC10697_04072 (hfq) Chromosome and associated proteins [BR:ptae03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NCTC10697_04072 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Gag_p24_C Motif Other DBs NCBI-ProteinID:  SQF88251 LinkDB All DBs Position 1:complement(4368342..4368602) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSAAESELADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaatactttgcgtaaagagaaggtt ggcgtttccatctacttggtcaacgggatcaagctgcaggggaccatcgaatctttcgat cagttcgttattctgctgaaaaacactgttagccaaatggtttacaaacacgctatctcg acagtagtaccagttcgcccaattcgtttgcctagcgcagctgaatcggaactggcagat gctgaaccaggtaacgcctga

DBGET integrated database retrieval system