KEGG   Pan troglodytes (chimpanzee): 459601
Entry
459601            CDS       T01005                                 
Name
(RefSeq) ras-related protein Rab-6C
  KO
K07895  Ras-related protein Rab-6C
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    459601
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ptr04031]
    459601
Membrane trafficking [BR:ptr04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    459601
GTP-binding proteins [BR:ptr04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    459601
SSDB
Motif
Pfam: Ras Roc Arf SRPRB CPT
Other DBs
NCBI-GeneID: 459601
NCBI-ProteinID: XP_003954210
LinkDB
Position
2B:16419299..16422597
AA seq 254 aa
MSAGGDLGNPLRKFKLVFLGEQSVAKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDG
TIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
ITLVGNRTDLADKRQVSIEEGERKAKGLNVRFIETRAKAGYNVKQLFRRVAAALPGMEST
QDRSREDMSDIKLEKPQEQPVSEGDCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSL
ITFCNSSLLPVSWR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacctcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcaaagcgttgcaaagacatctttgatcaccagattcatgtatgacagttttgacaac
acctatcaggcaacaattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcgggcttcggctgtgggatacggcgggtcaggaacgtctccgtagcctcattccc
aggtacatccgtgattctgctgcagctgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcacgctagtaggaaatagaacagatcttgctgacaagaggcaagtgtcaattgaggag
ggagagaggaaagccaaagggctgaatgttaggtttattgaaactagggcaaaagctgga
tacaatgtaaagcagctctttcgacgtgtagcagcagctttgccgggaatggaaagcaca
caggacagaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaacca
gtcagcgaaggggattgttcctgctactctcccatgtcatcttcaacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcatta
ataacgttttgcaattcatcattgctccctgtctcgtggagatga

DBGET integrated database retrieval system