Pan troglodytes (chimpanzee): 471723 Help Entry 471723            CDS       T01005                                  Symbol IL12B Name (RefSeq) interleukin-12 subunit beta   KO K05425   interleukin 12B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04620   Toll-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04625   C-type lectin receptor signaling pathway ptr04630   JAK-STAT signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04936   Alcoholic liver disease ptr04940   Type I diabetes mellitus ptr05133   Pertussis ptr05134   Legionellosis ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05143   African trypanosomiasis ptr05145   Toxoplasmosis ptr05146   Amoebiasis ptr05152   Tuberculosis ptr05162   Measles ptr05164   Influenza A ptr05168   Herpes simplex virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05205   Proteoglycans in cancer ptr05321   Inflammatory bowel disease ptr05330   Allograft rejection ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     471723 (IL12B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     471723 (IL12B)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     471723 (IL12B)    04622 RIG-I-like receptor signaling pathway     471723 (IL12B)    04625 C-type lectin receptor signaling pathway     471723 (IL12B)    04658 Th1 and Th2 cell differentiation     471723 (IL12B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     471723 (IL12B)    05205 Proteoglycans in cancer     471723 (IL12B)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     471723 (IL12B)    05164 Influenza A     471723 (IL12B)    05162 Measles     471723 (IL12B)    05168 Herpes simplex virus 1 infection     471723 (IL12B)   09171 Infectious disease: bacterial    05133 Pertussis     471723 (IL12B)    05134 Legionellosis     471723 (IL12B)    05152 Tuberculosis     471723 (IL12B)   09174 Infectious disease: parasitic    05146 Amoebiasis     471723 (IL12B)    05145 Toxoplasmosis     471723 (IL12B)    05140 Leishmaniasis     471723 (IL12B)    05142 Chagas disease     471723 (IL12B)    05143 African trypanosomiasis     471723 (IL12B)   09163 Immune disease    05321 Inflammatory bowel disease     471723 (IL12B)    05330 Allograft rejection     471723 (IL12B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     471723 (IL12B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     471723 (IL12B)    04936 Alcoholic liver disease     471723 (IL12B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     471723 (IL12B)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     471723 (IL12B) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interleukins    471723 (IL12B) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Cytokines    471723 (IL12B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12p40_C Ig_3 Ig_5 Ig_4 Ig_2 fn3 Ig_RIMBP2 I-set ig Motif Other DBs NCBI-GeneID:  471723 NCBI-ProteinID:  XP_527101 Ensembl:  ENSPTRG00000017481 VGNC:  4041 UniProt:  A0A6D2W675 H2QRX3 LinkDB All DBs Position 4:complement(157008093..157024690) Genome browser AA seq 328 aa AA seqDB search MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ KEPKTKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC RKNASISVRAQDRYYSSSWSEWASVPCS NT seq 987 nt NT seq  +upstreamnt  +downstreamnt atgtgtcaccagcagttggtcatctcttggttttccctggtttttctggcatctcccctc gtggccatatgggaactgaagaaagatgtttatgtcgtagaattggattggtatccggat gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg acctcggaccagagcagtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggttctaagccattca ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag aaagaacccaaaactaagacctttctaagatgcgaggccaagaattattcaggacgtttc acctgctggtggctgacgacaatcagtactgatttgacattcagtgtcaaaagcagcaga ggctcttctgacccccaaggggtgacgtgcggagctgctacactctctgcagagagggtc agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca gctgctgaggagagtctgcccattgaggtcatggtggatgctgttcacaagctcaagtat gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaac ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac acctggagtactccacattcctacttctccctgacattctgcgttcaggtccagggcaag agcaagagagaaaagaaagatagagtcttcacggacaagacctcagccacggtcatctgc cgcaaaaatgccagcattagcgtgcgggcccaggaccgctactatagctcatcttggagc gaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system