KEGG   Pseudoalteromonas tunicata: PTUN_a2926
Entry
PTUN_a2926        CDS       T05187                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00333  Prodigiosin biosynthesis
ptu01100  Metabolic pathways
ptu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PTUN_a2926
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: ATC95328
LinkDB
Position
I:complement(2678455..2681148)
AA seq 897 aa
MINAAMKLSTESDNIFRFTDMPLQSVSHIGGKGASLCAMSAAGLPVPAGVCLSVALFDDF
AAHIELLTRFDLTEGYEQWQAAAKAIKESPLPNTLQDTISAAIAHLKGPLAVRSSALDED
GESSSFAGQHLTKLALCGLDTILDAIKECWASAFSEAAYRYRQHTDKHLDMPRMAVVVQQ
MQFGDVSGVAFGQHPTTFARDAFLVENCFGLCEGLVSGQVVSDSWQIDKASGEVREVTIA
DKSEQIIYLDGEIQKVAVSDEQRQQPALGPMAQQALYTLLCKVEAYFGVPQDVEWTWSEG
KIWLLQSRPITTHAPQLDDFYLGSRDVDLQKTMLWSRMDIGEIFTGRMTPLGLSFARYYQ
QQVHTGCGKGLGLLDLGEADETIAYYRGHVYLNVSYTAWQLAQTPIGEDQLPFLQRFSSE
AIDLAGYRNPYGEKHSHQDYSAKQCTRYWLKKNIKELFCAKRRARSMIASRYKQFDRAQQ
KPLQQLSLEQLAAEMRHALAYFKAMHEGYLPYYINAFACYGILEELSALWLGDKGKQLHN
QIKGDMSNLRTVASAQELWLLCQQLADWPQVKQAFLDLELDELEVFLNEHQAGIKYSRGP
LAQFMRENGVRAREEMELTHPRWLDDRTYLLQMIKVYLHQGYAVDDAIATQQRKQRKNSN
EILKTIPWYQRRVMKLVISLYSGCAKLREETRMSMVTSIWLVRRIVYELGQRLVATQQLT
SLDDIAYLDFAEILSYLEKRIDVHQLTEPAKLAQRQSAYHLWQSMPEPPLTFIGSPKSQP
DLILDPTLTQLSGLATSAGFCRGKACVITDLAKQAGQFKKGDILIAPFTDASWTPLFALA
GAVVTDIGSMLSHSSIVAREFGIPCVVNTNHASALFKSGDMLIVDAQNGIVVLDKES
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgattaacgctgcgatgaagctctctactgagagcgataatattttccgctttacagat
atgccgcttcagtcggtatcacatattggtggcaaaggagcctcattgtgtgcaatgtca
gccgcaggtcttccggttcctgcaggtgtttgtttgagtgtggctttgtttgatgacttt
gcggcgcacattgagctactgacaaggttcgaccttactgaggggtatgaacagtggcaa
gctgctgccaaagcgattaaagagtctccattaccaaatacattacaagatacgataagc
gctgcaatagcacacctaaaagggccgttggctgttcgttcatcagcacttgatgaagat
ggtgaaagtagctcttttgctgggcaacatctgactaaattggccttgtgcgggcttgat
actatcctcgatgcgattaaagaatgttgggcatctgcttttagcgaggctgcgtatcgc
tatcgtcagcataccgacaaacacctcgacatgcctcgtatggcggtggttgtgcaacag
atgcaatttggagatgtttcaggcgtcgcgtttggtcaacatccaacgacctttgctcgt
gatgcctttttggttgaaaactgttttggtttgtgtgaagggttggtttctggtcaggtt
gttagcgatagctggcaaattgataaagcgtcgggcgaagtaagggaagtgactatcgcc
gataaatctgagcaaataatttatctagatggcgaaatacaaaaggttgcggtatccgac
gagcagcgccaacaacctgctttagggccaatggcacagcaggcgttatacaccttatta
tgtaaagttgaagcttattttggtgtgccacaagatgtggagtggacctggagtgaagga
aaaatttggttattacaaagccgccctatcacgacacatgcaccgcaactcgatgatttt
tacctaggttctcgagatgttgacttgcaaaaaaccatgttatggtcacgtatggatatt
ggggaaatattcaccggtcgcatgacgccgcttggtttatcatttgcccgttactatcag
caacaggtccacacaggttgtggtaaagggttaggtttgttggacttaggtgaggcggat
gaaaccatcgcctattatcgaggtcatgtatatctcaatgtttcttatactgcttggcaa
ttggctcaaactccaattggtgaagatcaattgccgtttttacagcgtttcagtagtgag
gctattgatttagcaggttaccgcaatccttatggcgaaaagcatagccatcaggattat
agcgccaaacagtgcactcgttattggctgaaaaagaacattaaagagctcttttgtgcc
aaacgtcgtgcgcgcagtatgatagcttcgcgctataaacagttcgaccgggctcagcaa
aaaccactgcagcagctttctttagagcagttggccgcagaaatgcgacatgctttggct
tattttaaagccatgcatgaaggttatttgccttactacattaacgcttttgcctgttac
ggaattttagaggaattaagtgcactgtggcttggcgacaaaggtaaacaattacataac
caaattaaaggcgatatgtctaacttgcgaactgttgcaagtgcacaggagctgtggctg
ctgtgccaacaattagccgattggccacaagtgaagcaagcatttttagatttagagctg
gacgaacttgaagtatttctcaatgaacatcaagctggaattaaatattctcgtggtcca
ttagcgcagtttatgcgcgaaaatggtgtgcgtgcacgcgaagaaatggagctgacacat
ccacgctggctcgatgaccgaacttatttattgcagatgattaaagtgtatctgcatcaa
ggttatgcggtagatgacgccatcgccacacaacaacgtaagcaacgtaaaaacagcaat
gaaatattaaaaacaatcccttggtatcaacgccgagtaatgaagctggtcatttcgctc
tacagtggttgtgccaaattacgtgaagagacacgtatgagtatggtgacctccatctgg
ttagttcgtcgtattgtttatgaactaggacagcgtttggttgcaactcagcaactcaca
tcactggatgatattgcttatttagattttgcagagatcttaagttatcttgaaaagcgc
atcgatgtgcaccagctcactgagcctgcaaagcttgcacaacgtcaatcggcttatcat
ctttggcaatcaatgcctgagccaccgttaacctttattggctcgccaaagagccaaccg
gatttaattttagacccaacattgacacagctgtctggccttgccacttcagccggtttt
tgccgtggcaaagcatgtgtgatcactgatttagccaagcaagcagggcaatttaaaaaa
ggcgatatattaattgctccttttaccgatgcatcttggacgccactttttgcacttgcg
ggtgcggtagtgacagacattggctcaatgttgtctcacagttccattgttgccagagaa
tttggcatcccatgtgtggtcaataccaatcatgccagcgcgttgtttaaatctggcgac
atgctgatagttgatgcacaaaatggcatcgtagttttagataaggaaagttaa

DBGET integrated database retrieval system