Pusillimonas sp. T7-7: PT7_1395 Help Entry PT7_1395          CDS       T01486                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism put  Pusillimonas sp. T7-7 Pathway put02024   Quorum sensing put03018   RNA degradation Brite KEGG Orthology (KO) [BR:put00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PT7_1395  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PT7_1395  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:put03019]     PT7_1395    03036 Chromosome and associated proteins [BR:put03036]     PT7_1395 Messenger RNA biogenesis [BR:put03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PT7_1395 Chromosome and associated proteins [BR:put03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PT7_1395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AEC19935 LinkDB All DBs Position complement(1507834..1508070) Genome browser AA seq 78 aa AA seqDB search MSNKGQTLQDPFLNALRKDHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFQVDEPSE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaataaagggcaaacactacaagatccatttctaaacgcccttcgcaaggaccac gtacctgtatcgatctacctggttaacggaatcaagctgcaagggcaggtcgagtctttc gaccagtatgtcgtactgctgcgcaataccgttacgcaaatggtctacaagcacgctatt tccaccgtcgtaccggcccgcccagtcaacttccaagtggatgagccttctgaataa

DBGET integrated database retrieval system