KEGG   Pseudoalteromonas viridis: J5X90_18220
Entry
J5X90_18220       CDS       T07232                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
pvb  Pseudoalteromonas viridis
Pathway
pvb00333  Prodigiosin biosynthesis
pvb01100  Metabolic pathways
pvb01110  Biosynthesis of secondary metabolites
Module
pvb_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:pvb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5X90_18220
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QTL35418
LinkDB
Position
1:4138390..4141038
AA seq 882 aa
MSQSLVVALSGNEQLELGHLGGKGHSLNHLIRAGLPVPPAFCITAEAYQTFVNTALPDEL
LSTAELDKVRSTILSADIPEPLRAAIASAYQGLGDNAQIAVRSSALDEDGQSQSFAGQYE
TYLHVQGSDSVMEKVRACWASLWAERAAGYRNSSAADTAIAVVLQTMVDADAAGVMFTQD
PLSGDTNKVVIDSCWGLGEGVVSGQVSTDSFILDKENGALLQQEIRVKPQYCQRNAQGQV
TLLNTPPEQQKTASLNEAQLAQLLSLAKQAQALYQTELDIEWALKDGKIWLLQARPVTTQ
ASKAEPIYANPWEQDQRIKDGAFFSRMDTGEIVTGLMTPLGLSFCEFYQKHIHGPAIKTM
GLADISDWQVYMGYIQGQVYLNISGSAHMLRQCPPTRDEMKFTTRYATSDIDFSNYRNPY
GRGVEGWDYAKSAWHWLKQQVHNMRNAGKIVEDMIALRENETKRFLALDLPSMSLSELDK
ELTRIDQYFLDSCAAYMPFFLQSFALYDALAETCEEHFKEQGEGLQNRIKASMNNLRTIE
VTRGIIDLVEHVQKNTELKAVFERFEAEELVNILPAHPLGQPFWQGPFEAFLLEFGARGR
QEFELSIPRWRDDPSYLLQVMKMYLKHPVDLEKKLKETESLREADSEQLFKALPAGARFK
LKTIIKLYGVMAERREATRPTFITETWFYRCIILEVLSRLERDNLAKVEDLPYIDFNRLR
DYVAGRMGAAEAFSESLLNANRHSHLFNLHAEEPPMAIIGPYTPKIKTTSQAHSDSMSGL
AASPGKVVAKARVITDLQAQAGELEPGEILVARFTDASWTPLFALASGVVTDIGSTLSHS
CIVAREFGIPAVVNLHSATAAIKSGDTLILDGDQGTVIIQRE
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgagtcaatcactcgtcgtcgccctcagtggcaacgaacaactggaattaggacatctg
ggcggcaaaggccactcgctgaatcatttgatccgtgcaggtctgcctgtaccacccgct
ttttgcatcaccgcagaggcgtatcagacgttcgtcaacaccgcgctgcccgatgagctg
ctcagtactgctgagctcgacaaagtccgaagcaccattctcagcgccgacattcccgag
ccgctgcgcgccgccatcgcatcggcctatcagggcttaggcgacaacgcacaaatcgct
gtgcgctcctccgccctggacgaggacggtcaaagccagagttttgctggtcagtacgaa
acctacctgcatgtgcagggcagcgacagcgtgatggaaaaagtgcgcgcatgctgggcc
tctttatgggcagagcgcgctgccggatatcgtaacagcagcgccgccgataccgccatt
gccgtggtgctgcaaactatggtggatgccgatgcggcgggggtgatgttcacgcaggat
ccgctcagcggcgataccaacaaggtcgttattgacagctgctggggtctgggtgaaggc
gtcgtatcaggtcaggtgagtaccgacagctttattctggataaagaaaacggtgcgctg
ttgcaacaggagatccgggtcaagcctcagtattgccagcgcaatgctcagggtcaggtt
actctactgaataccccgccagagcaacaaaaaaccgctagtctgaatgaagcgcaactg
gcgcaattgttatcgctggctaagcaggcacaagccttataccagaccgagctggatatc
gagtgggccctgaaagatggcaagatctggctgctgcaggcgcgtccggttaccactcag
gccagcaaagccgagcccatttacgccaatccgtgggagcaagatcagcgcatcaaagac
ggcgctttcttttcgcgcatggacaccggcgaaatagtcaccggactgatgacgccgctt
ggtttgtcattttgtgaattctaccaaaagcacattcatggccccgccatcaagaccatg
ggattggcagacattagtgactggcaggtttacatgggctatatccagggtcaggtgtat
ctgaatatctccggctcagcgcacatgttgcgccagtgcccacccactcgggacgaaatg
aaattcaccacccgctatgccacctcagacatagatttcagcaattatcgcaacccctat
ggtcgcggcgtcgaaggctgggactatgccaaaagtgcctggcactggctaaaacagcaa
gtacacaatatgcgcaatgcaggcaaaatcgttgaagacatgattgccctgcgagaaaac
gagaccaaacgttttctggcactggacttgcccagcatgtcactcagtgagctggataaa
gagctgactcgcatcgaccagtacttcctcgattcttgcgcagcctacatgccgtttttc
ctgcagtcatttgctttgtacgatgccctggcggaaacctgtgaagagcactttaaagag
caaggtgaagggctgcaaaatcgcatcaaggcctcgatgaacaacctgcgtaccatcgaa
gtcacacgtgggatcatcgacctggtagaacatgttcaaaagaacactgaactaaaagcc
gtatttgagcgctttgaagccgaagagctggtcaatatactgcccgctcatccgctggga
cagccgttctggcagggtccgtttgaagcctttttactggagtttggtgcccgcggccgg
caggaatttgagctgagtattccgcgctggcgtgacgacccaagctacctgctacaggtc
atgaaaatgtaccttaaacacccggttgacctggagaaaaagcttaaagaaaccgagagc
ctgcgcgaagccgacagcgagcaactctttaaagccttgccagccggggcacggtttaaa
ctcaaaaccatcattaaattgtatggcgtgatggcagagcgccgcgaagcaacacgcccg
acgtttatcaccgaaacctggttctatcgctgcatcattctggaggtgctatcacggctg
gaacgagacaacctggccaaggttgaagacttgccgtacatcgacttcaatcgactgcgt
gactatgtcgccgggcgcatgggtgcagccgaggcattcagcgagtcactgctcaatgcc
aaccgccacagtcatttgtttaaccttcatgccgaagagccgccaatggccatcattggg
ccttatacgcccaaaataaaaaccacctcacaagcgcacagcgattcgatgagtggcctg
gcagccagccccggcaaagtcgttgccaaagctcgcgtcatcaccgacttacaggcccag
gccggtgagctggagccaggtgaaattctggtcgcccgctttaccgatgccagctggaca
ccgctgttcgctctggccagtggcgttgtcacggacatcggttccactttgtcacacagc
tgtatcgtggcgcgagagtttggcattccggcggtggtgaacttacacagtgcgactgcg
gccattaaaagcggcgacacactgatccttgatggggaccagggcacagtgatcatccaa
cgagaatag

DBGET integrated database retrieval system