KEGG   Pseudoalteromonas viridis: J5X90_18270
Entry
J5X90_18270       CDS       T07232                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
pvb  Pseudoalteromonas viridis
Pathway
pvb00333  Prodigiosin biosynthesis
pvb01100  Metabolic pathways
pvb01110  Biosynthesis of secondary metabolites
Module
pvb_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:pvb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5X90_18270
SSDB
Motif
Pfam: TM1586_NiRdase Nitroreductase
Other DBs
NCBI-ProteinID: QTL35428
LinkDB
Position
1:4154378..4155460
AA seq 360 aa
MTHCTFEHALAEAIQLARLAPSSHNCQPWTVHFDPVIHCGYLAIDQRRKLTGLPSLEREM
LLSCGIFFHFLEQLVRLRGYPLHWRWCDAQEQQALAGEDRALIRFMPGPEQPQQQSAFAN
LSEQLQQRHTVRSAYRNTTLSTQQHSELNTLLKPYPITLGIYYQHTHGKALARLTQTYAG
LDFANRAAWRETYSYIRFDERRQYEDGFYLHNLFGPVSGGFKAFFKVAFHPRLSGLNKLL
GLPGKMAQGLAELVEAGPQYLALSTTKEGDEALFRTGLGLGAMWLRLQQWGWAMHPISVL
VQHDNARQALAESLSQAELPVFFARFGEPNESGSPAPRRHWQSILVSDTHSQAQPWTSGQ
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgacccattgtacatttgaacacgcgctggcagaggccattcaactggcacgtctggca
ccttcttcgcataactgtcagccctggacggtgcactttgatcccgtgatccactgcggc
tatctggccattgaccagcgtcgtaaactaaccggactgccctctttggagcgtgaaatg
ctgctcagctgtgggatttttttccattttcttgagcagctggtgcgtctgcgtggctac
ccgctacactggcgctggtgcgatgcacaagagcaacaggcattagctggcgaagacagg
gcccttattcgctttatgcccggcccagagcaaccccaacagcaaagcgcctttgccaat
ctctctgagcagctgcaacaacgccacaccgtgcgctctgcctatcgcaacacaacgctc
agtacgcagcaacacagcgagctgaacacattactgaaaccctaccccattacgctgggt
atttattatcagcacactcatggcaaggcactggcacgcctgacgcagacctatgccgga
ctggattttgccaaccgggccgcctggcgtgaaacctacagctatattcgctttgatgaa
cgtcgccagtatgaagacgggttttatctgcataacctgtttggaccggtctctggtggt
tttaaagccttttttaaagtggcatttcatccgcgactgagtggcttaaacaagctactg
gggttaccaggcaagatggcgcagggcctggcggagctggttgaagcggggccacagtat
ctggcactgagcaccacgaaggaaggcgatgaggctttatttcgcaccgggttagggttg
ggcgctatgtggctcaggctgcaacaatggggctgggccatgcacccgatcagcgtactg
gtgcaacacgacaacgccagacaagctttggccgagagcctgagccaggcggagctgccg
gttttctttgcccgatttggcgagccaaatgagtctggcagcccggctccgagaaggcac
tggcagagcattctggtctcagatacacatagccaggctcagccctggacctctggacag
tga

DBGET integrated database retrieval system