Penaeus vannamei (Pacific white shrimp): 113808679 Help Entry 113808679         CDS       T06111                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism pvm  Penaeus vannamei (Pacific white shrimp) Pathway pvm03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:pvm00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113808679  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvm03036]     113808679   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvm04147]     113808679 Chromosome and associated proteins [BR:pvm03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113808679 Exosome [BR:pvm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113808679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  113808679 NCBI-ProteinID:  XP_027215954 LinkDB All DBs Position 5:30054621..30055075 Genome browser AA seq 122 aa AA seqDB search MSGRGKGGKAKGKAKSRSSKAGLQFPVGRIHRLLRKGKYAERIGAGAPVYMAAVMEYLAA EILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKA EK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggaaagggcggcaaggcgaagggcaaggccaagtcccgctccagcaag gccggccttcagtttcctgtaggaaggattcaccgccttctgcgtaaagggaagtacgcg gaacgcataggcgctggtgctcctgtgtacatggctgctgtcatggaatatcttgcagct gaaatcctggaattggcaggaaatgcagcccgtgacaacaagaagagccgcatcatcccc cgccacttgcagctggccatccgtaacgacgaagagctcaacaagctgctgtctggcgtg accatcgcccagggcggtgtcctgcccaacatccaggctgtgctcctccccaagaaggcc gagaagtag

DBGET integrated database retrieval system