KEGG   Pteropus vampyrus (large flying fox): 105289326
Entry
105289326         CDS       T07815                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pvp  Pteropus vampyrus (large flying fox)
Pathway
pvp01521  EGFR tyrosine kinase inhibitor resistance
pvp01522  Endocrine resistance
pvp01524  Platinum drug resistance
pvp04010  MAPK signaling pathway
pvp04012  ErbB signaling pathway
pvp04014  Ras signaling pathway
pvp04015  Rap1 signaling pathway
pvp04022  cGMP-PKG signaling pathway
pvp04024  cAMP signaling pathway
pvp04062  Chemokine signaling pathway
pvp04066  HIF-1 signaling pathway
pvp04068  FoxO signaling pathway
pvp04071  Sphingolipid signaling pathway
pvp04072  Phospholipase D signaling pathway
pvp04114  Oocyte meiosis
pvp04140  Autophagy - animal
pvp04148  Efferocytosis
pvp04150  mTOR signaling pathway
pvp04151  PI3K-Akt signaling pathway
pvp04210  Apoptosis
pvp04218  Cellular senescence
pvp04261  Adrenergic signaling in cardiomyocytes
pvp04270  Vascular smooth muscle contraction
pvp04350  TGF-beta signaling pathway
pvp04360  Axon guidance
pvp04370  VEGF signaling pathway
pvp04371  Apelin signaling pathway
pvp04380  Osteoclast differentiation
pvp04510  Focal adhesion
pvp04517  IgSF CAM signaling
pvp04520  Adherens junction
pvp04540  Gap junction
pvp04550  Signaling pathways regulating pluripotency of stem cells
pvp04611  Platelet activation
pvp04613  Neutrophil extracellular trap formation
pvp04620  Toll-like receptor signaling pathway
pvp04621  NOD-like receptor signaling pathway
pvp04625  C-type lectin receptor signaling pathway
pvp04650  Natural killer cell mediated cytotoxicity
pvp04657  IL-17 signaling pathway
pvp04658  Th1 and Th2 cell differentiation
pvp04659  Th17 cell differentiation
pvp04660  T cell receptor signaling pathway
pvp04662  B cell receptor signaling pathway
pvp04664  Fc epsilon RI signaling pathway
pvp04666  Fc gamma R-mediated phagocytosis
pvp04668  TNF signaling pathway
pvp04713  Circadian entrainment
pvp04720  Long-term potentiation
pvp04722  Neurotrophin signaling pathway
pvp04723  Retrograde endocannabinoid signaling
pvp04724  Glutamatergic synapse
pvp04725  Cholinergic synapse
pvp04726  Serotonergic synapse
pvp04730  Long-term depression
pvp04810  Regulation of actin cytoskeleton
pvp04910  Insulin signaling pathway
pvp04912  GnRH signaling pathway
pvp04914  Progesterone-mediated oocyte maturation
pvp04915  Estrogen signaling pathway
pvp04916  Melanogenesis
pvp04917  Prolactin signaling pathway
pvp04919  Thyroid hormone signaling pathway
pvp04921  Oxytocin signaling pathway
pvp04926  Relaxin signaling pathway
pvp04928  Parathyroid hormone synthesis, secretion and action
pvp04929  GnRH secretion
pvp04930  Type II diabetes mellitus
pvp04933  AGE-RAGE signaling pathway in diabetic complications
pvp04934  Cushing syndrome
pvp04935  Growth hormone synthesis, secretion and action
pvp04960  Aldosterone-regulated sodium reabsorption
pvp05010  Alzheimer disease
pvp05020  Prion disease
pvp05022  Pathways of neurodegeneration - multiple diseases
pvp05034  Alcoholism
pvp05132  Salmonella infection
pvp05133  Pertussis
pvp05135  Yersinia infection
pvp05140  Leishmaniasis
pvp05142  Chagas disease
pvp05145  Toxoplasmosis
pvp05152  Tuberculosis
pvp05160  Hepatitis C
pvp05161  Hepatitis B
pvp05163  Human cytomegalovirus infection
pvp05164  Influenza A
pvp05165  Human papillomavirus infection
pvp05166  Human T-cell leukemia virus 1 infection
pvp05167  Kaposi sarcoma-associated herpesvirus infection
pvp05170  Human immunodeficiency virus 1 infection
pvp05171  Coronavirus disease - COVID-19
pvp05200  Pathways in cancer
pvp05203  Viral carcinogenesis
pvp05205  Proteoglycans in cancer
pvp05206  MicroRNAs in cancer
pvp05207  Chemical carcinogenesis - receptor activation
pvp05208  Chemical carcinogenesis - reactive oxygen species
pvp05210  Colorectal cancer
pvp05211  Renal cell carcinoma
pvp05212  Pancreatic cancer
pvp05213  Endometrial cancer
pvp05214  Glioma
pvp05215  Prostate cancer
pvp05216  Thyroid cancer
pvp05218  Melanoma
pvp05219  Bladder cancer
pvp05220  Chronic myeloid leukemia
pvp05221  Acute myeloid leukemia
pvp05223  Non-small cell lung cancer
pvp05224  Breast cancer
pvp05225  Hepatocellular carcinoma
pvp05226  Gastric cancer
pvp05230  Central carbon metabolism in cancer
pvp05231  Choline metabolism in cancer
pvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105289326 (MAPK1)
   04012 ErbB signaling pathway
    105289326 (MAPK1)
   04014 Ras signaling pathway
    105289326 (MAPK1)
   04015 Rap1 signaling pathway
    105289326 (MAPK1)
   04350 TGF-beta signaling pathway
    105289326 (MAPK1)
   04370 VEGF signaling pathway
    105289326 (MAPK1)
   04371 Apelin signaling pathway
    105289326 (MAPK1)
   04668 TNF signaling pathway
    105289326 (MAPK1)
   04066 HIF-1 signaling pathway
    105289326 (MAPK1)
   04068 FoxO signaling pathway
    105289326 (MAPK1)
   04072 Phospholipase D signaling pathway
    105289326 (MAPK1)
   04071 Sphingolipid signaling pathway
    105289326 (MAPK1)
   04024 cAMP signaling pathway
    105289326 (MAPK1)
   04022 cGMP-PKG signaling pathway
    105289326 (MAPK1)
   04151 PI3K-Akt signaling pathway
    105289326 (MAPK1)
   04150 mTOR signaling pathway
    105289326 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    105289326 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105289326 (MAPK1)
   04148 Efferocytosis
    105289326 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105289326 (MAPK1)
   04210 Apoptosis
    105289326 (MAPK1)
   04218 Cellular senescence
    105289326 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105289326 (MAPK1)
   04520 Adherens junction
    105289326 (MAPK1)
   04540 Gap junction
    105289326 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    105289326 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105289326 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105289326 (MAPK1)
   04613 Neutrophil extracellular trap formation
    105289326 (MAPK1)
   04620 Toll-like receptor signaling pathway
    105289326 (MAPK1)
   04621 NOD-like receptor signaling pathway
    105289326 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    105289326 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    105289326 (MAPK1)
   04660 T cell receptor signaling pathway
    105289326 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    105289326 (MAPK1)
   04659 Th17 cell differentiation
    105289326 (MAPK1)
   04657 IL-17 signaling pathway
    105289326 (MAPK1)
   04662 B cell receptor signaling pathway
    105289326 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    105289326 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    105289326 (MAPK1)
   04062 Chemokine signaling pathway
    105289326 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105289326 (MAPK1)
   04929 GnRH secretion
    105289326 (MAPK1)
   04912 GnRH signaling pathway
    105289326 (MAPK1)
   04915 Estrogen signaling pathway
    105289326 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    105289326 (MAPK1)
   04917 Prolactin signaling pathway
    105289326 (MAPK1)
   04921 Oxytocin signaling pathway
    105289326 (MAPK1)
   04926 Relaxin signaling pathway
    105289326 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    105289326 (MAPK1)
   04919 Thyroid hormone signaling pathway
    105289326 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    105289326 (MAPK1)
   04916 Melanogenesis
    105289326 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105289326 (MAPK1)
   04270 Vascular smooth muscle contraction
    105289326 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105289326 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    105289326 (MAPK1)
   04725 Cholinergic synapse
    105289326 (MAPK1)
   04726 Serotonergic synapse
    105289326 (MAPK1)
   04720 Long-term potentiation
    105289326 (MAPK1)
   04730 Long-term depression
    105289326 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    105289326 (MAPK1)
   04722 Neurotrophin signaling pathway
    105289326 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    105289326 (MAPK1)
   04380 Osteoclast differentiation
    105289326 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105289326 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105289326 (MAPK1)
   05206 MicroRNAs in cancer
    105289326 (MAPK1)
   05205 Proteoglycans in cancer
    105289326 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    105289326 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    105289326 (MAPK1)
   05203 Viral carcinogenesis
    105289326 (MAPK1)
   05230 Central carbon metabolism in cancer
    105289326 (MAPK1)
   05231 Choline metabolism in cancer
    105289326 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105289326 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105289326 (MAPK1)
   05212 Pancreatic cancer
    105289326 (MAPK1)
   05225 Hepatocellular carcinoma
    105289326 (MAPK1)
   05226 Gastric cancer
    105289326 (MAPK1)
   05214 Glioma
    105289326 (MAPK1)
   05216 Thyroid cancer
    105289326 (MAPK1)
   05221 Acute myeloid leukemia
    105289326 (MAPK1)
   05220 Chronic myeloid leukemia
    105289326 (MAPK1)
   05218 Melanoma
    105289326 (MAPK1)
   05211 Renal cell carcinoma
    105289326 (MAPK1)
   05219 Bladder cancer
    105289326 (MAPK1)
   05215 Prostate cancer
    105289326 (MAPK1)
   05213 Endometrial cancer
    105289326 (MAPK1)
   05224 Breast cancer
    105289326 (MAPK1)
   05223 Non-small cell lung cancer
    105289326 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105289326 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    105289326 (MAPK1)
   05161 Hepatitis B
    105289326 (MAPK1)
   05160 Hepatitis C
    105289326 (MAPK1)
   05171 Coronavirus disease - COVID-19
    105289326 (MAPK1)
   05164 Influenza A
    105289326 (MAPK1)
   05163 Human cytomegalovirus infection
    105289326 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105289326 (MAPK1)
   05165 Human papillomavirus infection
    105289326 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105289326 (MAPK1)
   05135 Yersinia infection
    105289326 (MAPK1)
   05133 Pertussis
    105289326 (MAPK1)
   05152 Tuberculosis
    105289326 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105289326 (MAPK1)
   05140 Leishmaniasis
    105289326 (MAPK1)
   05142 Chagas disease
    105289326 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105289326 (MAPK1)
   05020 Prion disease
    105289326 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    105289326 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    105289326 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105289326 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105289326 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105289326 (MAPK1)
   04934 Cushing syndrome
    105289326 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105289326 (MAPK1)
   01524 Platinum drug resistance
    105289326 (MAPK1)
   01522 Endocrine resistance
    105289326 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvp01001]
    105289326 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pvp03036]
    105289326 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvp04147]
    105289326 (MAPK1)
Enzymes [BR:pvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105289326 (MAPK1)
Protein kinases [BR:pvp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105289326 (MAPK1)
Chromosome and associated proteins [BR:pvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105289326 (MAPK1)
Exosome [BR:pvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105289326 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 105289326
NCBI-ProteinID: XP_011354257
UniProt: A0A6P3Q501
LinkDB
Position
Unknown
AA seq 359 aa
MAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgacgtg
gggccgcgctacaccaacctctcgtacatcggcgagggcgcttacggcatggtgtgctct
gcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccttttgagcac
cagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacacgag
aacatcattggaatcaatgatattattcgagcgccaaccatcgagcaaatgaaagatgta
tatatagtgcaggacctcatggaaacagatctctacaagctcttgaagacacaacacctc
agcaacgaccatatctgctattttctttaccagatcctcagagggttaaagtatatccat
tcagctaatgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacctgt
gatctcaagatctgtgattttggcttggcccgtgttgcagatccagaccatgatcacaca
gggttcctgacggagtatgtagccacacgttggtacagggctccagaaattatgttgaat
tccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagagatg
ctctccaacaggcctatcttccctgggaagcactatctcgaccagctgaaccacattctg
ggtattcttggatccccatcacaggaagacctgaattgcataatcaatttaaaagctaga
aactatttgctttctcttccacacaaaaataaggtgccatggaacaggttgttcccaaat
gctgactccaaagctctggatttactggacaaaatgttgactttcaaccctcacaagagg
attgaagtggaacaggcgctggcccacccatatctggagcagtattatgacccaagtgat
gagcccattgctgaagcaccgttcaagtttgacatggaattggatgacttgcctaaggag
aagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system