Pteropus vampyrus (large flying fox): 105293681 Help Entry 105293681         CDS       T07815                                  Symbol AQP1 Name (RefSeq) aquaporin-1 isoform X2   KO K09864   aquaporin-1 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04924   Renin secretion pvp04964   Proximal tubule bicarbonate reclamation pvp04976   Bile secretion Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09152 Endocrine system    04924 Renin secretion     105293681 (AQP1)   09154 Digestive system    04976 Bile secretion     105293681 (AQP1)   09155 Excretory system    04964 Proximal tubule bicarbonate reclamation     105293681 (AQP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pvp02000]     105293681 (AQP1)    04147 Exosome [BR:pvp04147]     105293681 (AQP1) Transporters [BR:pvp02000]  Other transporters   Aquaporins and small neutral solute transporters [TC:1.A.8]    Aquaporins     105293681 (AQP1) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105293681 (AQP1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MIP Motif Other DBs NCBI-GeneID:  105293681 NCBI-ProteinID:  XP_011360806 UniProt:  A0A6P3QAI9 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MASEFKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLKNNQTSGATQDNVKVSLAFGL SIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSS LSNNSLGRNELAPGVNSCT NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggccagcgagttcaagaagaagctcttctggagggcggtggtggccgagttcctggcc atgaccctcttcgtcttcatcagcattggttctgccttgggcttcaactaccccttgaag aacaaccagacgtcgggtgcgactcaggacaacgtgaaggtgtcactggctttcgggctg agcatcgccacgctggcccagagcgtgggccacatcagcggtgcccacctcaacccggcc gtcacgctggggctgctgctcagctgccagatcagcatcctccgggccgtcatgtacatc atcgcccagtgcgtgggggccatcgtcgccaccgccatcctctcaggcatcacctcctcc ctgagcaacaactctctcggccgcaatgagctggcccctggtgtgaactcgtgcacataa

DBGET integrated database retrieval system