KEGG   Pteropus vampyrus (large flying fox): 105304500
Entry
105304500         CDS       T07815                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pvp  Pteropus vampyrus (large flying fox)
Pathway
pvp04610  Complement and coagulation cascades
pvp04810  Regulation of actin cytoskeleton
pvp05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pvp00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105304500 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    105304500 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105304500 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pvp04515]
    105304500 (ITGAX)
   04090 CD molecules [BR:pvp04090]
    105304500 (ITGAX)
Cell adhesion molecules [BR:pvp04515]
 Integrins
  Integrin alpha subunits
   105304500 (ITGAX)
CD molecules [BR:pvp04090]
 Proteins
  105304500 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha FG-GAP_3 VWA_CoxE
Other DBs
NCBI-GeneID: 105304500
NCBI-ProteinID: XP_011376885
UniProt: A0A6P3RGA7
LinkDB
Position
Unknown
AA seq 1157 aa
MTGTGTSLLLLMTLASSVCFNLDTDKPTTFLMDSAGFGHSVVQYANSWVVVGAPQEIKAA
NQTGGLYQCDYSTATCEPIRLQVPPEAVNMSLGLSLTASTNPSQLLACGPTVHHACRENM
YLTGFCFLLSFPSWQAQRLPSALQECPKQEQDIVFLIDGSGSISSNDFAKMLNFVKAVMS
QFQRPNTQFSLMQFSNQFRVHFTFKDFTYNSDPLGLLDSVYQLRGATHTATAIRKVIKQL
FSAPSGARNDASKILIVITDGNKQGDYLDYKDVIPMAEAAGIIRYAVGVGSAFRETNSWK
ELNDIASSPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQEGFSAV
FAPDGPVLGAVGSFSWSGGAFLYPPNISPIFINMSQEHVDMRDSYLGYSTELALWKGVQI
LVLGAPRHQHTGKVVLFAQVSRQWRPKAEVTGTQIGSYFGASLCSVDVDRDGSSDLVLIG
APHYHEPTRGGQVSVCPFPRGRARWQCEFILCGEQGHPWGRFGAALTVLGDVNGDKLMDV
AIGAPGEQENQGAVYLFHGTLGLGISLIHSQRIAGSQFFPRLQYFGQSLSGGQDLTLDGL
VDLAVGAQGHALLLRTRPVLRVWVSIRITPAEITRSVFECQEQMPFVQPLVNANVCLHVY
KSSKDRLGDLQSSVTFDLTLDPGRLSPRAIFEETKTWNLTRVRVLGLRQHCEDVRFLLLA
CVEDSVTPITLRLNFSLVGKPKPSFGNLQPILAVDAPRYFVASLPFEKNCGADHVCQDDL
GISFGFSGLKTLVVGSNLELNMEVRVWNDGEDSYGTTVTFFYPPGLSYRRVAGSQSQLQS
QSLRLTCDSAPAESQGIQSTHCSIKHLIFREGAQITFTATFDVSPKAMLGDRLLLMGNVS
SENNTPRTSKTTFQLELPVKYAVYTIITSHEGSTKYLNFSTSEEEESSMVQHRYQVNNLG
QRGLSISVNFLVPVELNQVTVWKEIEVFSPQNPSIQCSSERIVPTESSFMTHIQKNPVLD
CSIADCLRFRCDIPSFGIQEELDFILKGNLSFGWISQTLQKNVFIVSVAEITFNRSVYSQ
LPGQEVFLRAQIEMVLEKYEVHNPMPLIVGSSVGGLLLLALITAILYKVGFFKRQYKEMM
EKANGGTAPENGTSDPQ
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgaccgggaccgggacatctcttctcctattgatgaccttggcttcctctgtctgcttc
aacttggacacagacaagccgacaaccttcctcatggacagtgctgggtttggacacagt
gtggtccagtatgccaactcctgggtggttgttggagctcctcaggagataaaggctgcc
aaccaaacaggtggcctctaccaatgtgactacagcacagccacttgtgagcccatccgc
ctacaggtacccccggaggctgtgaacatgtccctgggcctgtccctgacagcttccacc
aatccctctcagctgctggcctgtggtcccactgtgcaccatgcctgcagagagaacatg
tatttgactggtttctgcttcctgctgtccttcccctcctggcaggcccagaggctccct
tctgccctgcaggagtgcccaaagcaggagcaggacatcgtgttcctaattgatggctcg
ggcagcatctcctctaatgattttgcaaagatgctgaacttcgtgaaggctgtaatgagc
cagttccagagacccaacacccagttctccctgatgcagttctccaaccaatttcgggtg
catttcactttcaaagacttcacttacaactcagacccactaggcctgttggattctgtg
taccagctgagaggggccactcacacagccacagccatcaggaaggtcataaaacaattg
ttcagtgctccaagtggggcccgaaatgatgcctccaagatcctcatcgtcatcactgat
gggaataaacaaggcgactacctggattataaggatgtcatccccatggctgaggcagcg
ggcatcatccgctatgcagtcggggtgggatcggcttttcgagagacaaattcctggaaa
gaattaaatgacattgcatcaagtccctcccatgaatatatatttaaagtggagaacttt
gacgctttgagagacattcaaaaccaactgaaagagaagatctttgccattgagggtaca
cagaccataagcagtagttcctttgaattggagatgtcccaggagggcttcagcgctgta
ttcgcacctgatggaccagttctaggggctgtgggaagcttcagctggtctggaggtgcc
ttcctgtaccccccaaatataagccccatcttcatcaacatgtctcaagaacatgtggac
atgagggactcttatttgggttactccacagagctggccctttggaagggggtgcagatc
ctggtcctgggggccccccgtcatcagcacactgggaaagttgtcctcttcgcccaggtg
tccaggcaatggaggccgaaggctgaagtcacagggacccagatcggctcctacttcggg
gcctccctctgctctgtggacgtggacagagatggcagctccgacctggtcctcatcggg
gcccctcattaccatgagccgacccgggggggccaggtgtctgtgtgcccctttccccgg
gggagggctaggtggcagtgtgagttcattctctgtggggagcaaggccacccctggggc
cgctttggggcagccttgacagtgctgggggacgtgaatggggacaagctgatggacgtg
gccattggagccccgggagagcaggagaaccagggtgctgtctacctatttcatggaacc
ttaggactgggcatcagcctcatccacagccagaggattgcaggatcccagttcttcccc
aggctccagtattttgggcagtcgctgagcggaggtcaagatctcaccctggatggactg
gtggacctggctgtgggggcccaggggcatgcactgctgctcagaaccagacctgtgctc
agggtatgggtgagcatccgcatcacacctgcagagatcaccaggtctgtgtttgagtgt
caggagcagatgccctttgtccagccactggttaatgccaatgtctgccttcatgtttat
aaaagctccaaggaccgactgggtgacctccaaagctctgtgacctttgacctgaccctt
gaccctggccgcctgagtccccgggccatctttgaggagacaaagacttggaatctgact
cgtgtcagagtccttgggctgagacagcattgtgaggacgtgaggttccttctcctggcc
tgtgtggaggactcagtgacccccattaccttgcgtctcaatttctccctggtgggcaag
cccaaaccttcctttggaaacctacagcctatattggctgtggatgctcccagatacttc
gtggcctctcttccctttgagaagaactgtggagccgaccacgtctgccaggatgacctt
ggcatctcctttggcttctcaggcttgaagaccctggtggtggggagtaacctggagctg
aacatggaagtaagagtgtggaatgatggtgaggactcctatggaaccacagtcaccttc
ttctacccaccaggcctgtcttatcgacgtgtggcagggagccagagccagctgcagtca
caatccctgcgcctgacctgtgacagtgccccagctgagagccagggcatccagagtacc
cactgcagcatcaaacacctcatcttccgcgagggtgcccagatcaccttcacggctacc
tttgatgtttcccctaaggccatgctgggagaccggctgcttctgatgggcaatgtgagt
agtgagaataacacccctaggaccagcaagaccaccttccagctggagctcccggtgaag
tatgctgtctacactataatcaccagccatgaaggatccactaagtacctcaacttctcg
acctcagaggaggaagaaagcagcatggtccaacatagataccaggtgaacaacctggga
cagagaggtctttccataagtgtcaacttcttggtgcctgtggaactgaaccaggtgact
gtttggaaagagatagaagtcttctccccccagaacccatctattcagtgctcttcagag
agaatagtgcccacagagtccagcttcatgacccacattcagaagaatcctgtgctggac
tgctccattgctgactgcctgaggttccgctgtgacataccctccttcggcatccaagag
gaacttgacttcatcctgaagggcaacctcagctttggctggatcagccagacattgcag
aagaatgtatttattgtgagtgtggctgaaatcacgttcaacagatctgtgtactctcag
cttccaggacaggaggtgtttttgagagcccagatagagatggtgctggagaagtatgag
gtccacaaccccatgcccctcattgtgggcagctcagtgggaggactactgctgctggct
ctaatcacagccatactgtacaaagttggcttcttcaaacgtcagtacaaggaaatgatg
gagaaggcaaatggaggaactgccccagaaaatgggacatcagacccccaataa

DBGET integrated database retrieval system