Pteropus vampyrus (large flying fox): 105305325 Help Entry 105305325         CDS       T07815                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp01523   Antifolate resistance pvp04010   MAPK signaling pathway pvp04060   Cytokine-cytokine receptor interaction pvp04061   Viral protein interaction with cytokine and cytokine receptor pvp04064   NF-kappa B signaling pathway pvp04071   Sphingolipid signaling pathway pvp04150   mTOR signaling pathway pvp04210   Apoptosis pvp04217   Necroptosis pvp04350   TGF-beta signaling pathway pvp04380   Osteoclast differentiation pvp04612   Antigen processing and presentation pvp04620   Toll-like receptor signaling pathway pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway pvp04625   C-type lectin receptor signaling pathway pvp04640   Hematopoietic cell lineage pvp04650   Natural killer cell mediated cytotoxicity pvp04657   IL-17 signaling pathway pvp04660   T cell receptor signaling pathway pvp04664   Fc epsilon RI signaling pathway pvp04668   TNF signaling pathway pvp04920   Adipocytokine signaling pathway pvp04930   Type II diabetes mellitus pvp04931   Insulin resistance pvp04932   Non-alcoholic fatty liver disease pvp04933   AGE-RAGE signaling pathway in diabetic complications pvp04936   Alcoholic liver disease pvp04940   Type I diabetes mellitus pvp05010   Alzheimer disease pvp05014   Amyotrophic lateral sclerosis pvp05020   Prion disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05132   Salmonella infection pvp05133   Pertussis pvp05134   Legionellosis pvp05135   Yersinia infection pvp05140   Leishmaniasis pvp05142   Chagas disease pvp05143   African trypanosomiasis pvp05144   Malaria pvp05145   Toxoplasmosis pvp05146   Amoebiasis pvp05152   Tuberculosis pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05163   Human cytomegalovirus infection pvp05164   Influenza A pvp05165   Human papillomavirus infection pvp05166   Human T-cell leukemia virus 1 infection pvp05168   Herpes simplex virus 1 infection pvp05169   Epstein-Barr virus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05205   Proteoglycans in cancer pvp05310   Asthma pvp05321   Inflammatory bowel disease pvp05322   Systemic lupus erythematosus pvp05323   Rheumatoid arthritis pvp05330   Allograft rejection pvp05332   Graft-versus-host disease pvp05410   Hypertrophic cardiomyopathy pvp05414   Dilated cardiomyopathy pvp05417   Lipid and atherosclerosis pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105305325 (TNF)    04350 TGF-beta signaling pathway     105305325 (TNF)    04064 NF-kappa B signaling pathway     105305325 (TNF)    04668 TNF signaling pathway     105305325 (TNF)    04071 Sphingolipid signaling pathway     105305325 (TNF)    04150 mTOR signaling pathway     105305325 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105305325 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     105305325 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105305325 (TNF)    04217 Necroptosis     105305325 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105305325 (TNF)    04620 Toll-like receptor signaling pathway     105305325 (TNF)    04621 NOD-like receptor signaling pathway     105305325 (TNF)    04622 RIG-I-like receptor signaling pathway     105305325 (TNF)    04625 C-type lectin receptor signaling pathway     105305325 (TNF)    04650 Natural killer cell mediated cytotoxicity     105305325 (TNF)    04612 Antigen processing and presentation     105305325 (TNF)    04660 T cell receptor signaling pathway     105305325 (TNF)    04657 IL-17 signaling pathway     105305325 (TNF)    04664 Fc epsilon RI signaling pathway     105305325 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105305325 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     105305325 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105305325 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105305325 (TNF)    05170 Human immunodeficiency virus 1 infection     105305325 (TNF)    05161 Hepatitis B     105305325 (TNF)    05160 Hepatitis C     105305325 (TNF)    05171 Coronavirus disease - COVID-19     105305325 (TNF)    05164 Influenza A     105305325 (TNF)    05168 Herpes simplex virus 1 infection     105305325 (TNF)    05163 Human cytomegalovirus infection     105305325 (TNF)    05169 Epstein-Barr virus infection     105305325 (TNF)    05165 Human papillomavirus infection     105305325 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     105305325 (TNF)    05135 Yersinia infection     105305325 (TNF)    05133 Pertussis     105305325 (TNF)    05134 Legionellosis     105305325 (TNF)    05152 Tuberculosis     105305325 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     105305325 (TNF)    05144 Malaria     105305325 (TNF)    05145 Toxoplasmosis     105305325 (TNF)    05140 Leishmaniasis     105305325 (TNF)    05142 Chagas disease     105305325 (TNF)    05143 African trypanosomiasis     105305325 (TNF)   09163 Immune disease    05310 Asthma     105305325 (TNF)    05322 Systemic lupus erythematosus     105305325 (TNF)    05323 Rheumatoid arthritis     105305325 (TNF)    05321 Inflammatory bowel disease     105305325 (TNF)    05330 Allograft rejection     105305325 (TNF)    05332 Graft-versus-host disease     105305325 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     105305325 (TNF)    05014 Amyotrophic lateral sclerosis     105305325 (TNF)    05020 Prion disease     105305325 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     105305325 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105305325 (TNF)    05418 Fluid shear stress and atherosclerosis     105305325 (TNF)    05410 Hypertrophic cardiomyopathy     105305325 (TNF)    05414 Dilated cardiomyopathy     105305325 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     105305325 (TNF)    04940 Type I diabetes mellitus     105305325 (TNF)    04936 Alcoholic liver disease     105305325 (TNF)    04932 Non-alcoholic fatty liver disease     105305325 (TNF)    04931 Insulin resistance     105305325 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     105305325 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105305325 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvp04052]     105305325 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pvp00536]     105305325 (TNF) Cytokines and neuropeptides [BR:pvp04052]  Cytokines   Tumor necrosis fators    105305325 (TNF) Glycosaminoglycan binding proteins [BR:pvp00536]  Heparan sulfate / Heparin   Cytokines    105305325 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  105305325 NCBI-ProteinID:  XP_011378193 UniProt:  A0A6P3RJ21 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEELPKKAGGPQASRRCLCLSLFSFLLVAGATMLFCLLHFGVIGPQR EEFPTGLPLIKPLAQTLGLSSRTPSDKPVAHVVANPQAEGQLQWLSQRANALLANGMKLT DNQLVVPLDGLYLIYSQVLFKGQGCPQTHVLLTHTISRFADSYQTKVNLLSAIKSPCQRE TQEGAAAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggatgtggagctggctgaggaggaactccccaagaag gcaggggggccccaggcctccagacggtgcctgtgcctcagcctcttctcctttctcctc gtggcaggagccaccatgctcttctgcctgctgcacttcggagtgattggcccccagaga gaagagttcccgactggcctcccactaatcaaacctctggcccagactcttggattatct tctcgaaccccaagtgacaagcctgtcgcccatgttgtagcaaacccccaagccgaggga cagctccagtggctgagccagcgtgccaatgctctcctggccaatggcatgaagctgaca gacaaccagctggtggtgccattagatgggctgtacctcatctactcccaggtcctcttc aaaggtcaaggctgccctcaaacccatgtactcctcacccacaccatcagccgcttcgct gactcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggaa acccaagagggggctgcggccaagccctggtatgagcccatctacctgggaggagtcttc cagctagagaagggtgatcgactcagtgccgagatcaacctgcctgactatcttgacttt gctgagtctgggcaggtctactttgggatcattgccttgtga

DBGET integrated database retrieval system