KEGG   Plasmodium vivax: PVX_114505
Entry
PVX_114505        CDS       T01073                                 

Definition
(RefSeq) 6-pyruvoyl tetrahydrobiopterin synthase
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
pvx  Plasmodium vivax
Pathway
pvx00790  Folate biosynthesis
pvx01100  Metabolic pathways
pvx01240  Biosynthesis of cofactors
Module
pvx_M00841  Tetrahydrofolate biosynthesis, mediated by PTPS, GTP => THF
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PVX_114505
Enzymes [BR:pvx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     PVX_114505
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     PVX_114505
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-GeneID: 5475588
NCBI-ProteinID: XP_001616289
UniProt: A0A1G4GZR7 A5K2B2
LinkDB
Structure
PDB: 
3LX3 3M0N 3LZE 2A0S

Position
11
AA seq 172 aa
MNPHPVEPRDQIAELLVESPLFSFNCAHFIAFKGFRETLHGHNYNVSLRLRGNIQGDGYV
IDFSILKEKVRKVCKQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIP
IKHSSTEEIGLYILNQLIEEIDLPFLKTRSVNYMEVTVSESPSQKATVHRNI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaacccccatccagttgagccccgtgaccagatagcagaactgctggtggagtctcct
ctgttttcgttcaactgcgcacactttatagcctttaaaggatttagggaaactttgcat
gggcataattataatgtgtccttaagactaagggggaatatacaaggggatggatatgta
atcgacttctccattttgaaagaaaaagtgagaaaagtttgcaaacagctcgatcaccat
ttcattctgccaatgtacagtgatgttctaaacatccaagaagttaacgacaattttaaa
attacatgtgaagataactccgagtattctttccccaaacgggactgtgtgcaaattcct
atcaagcattcctccacagaagaaataggcctctatattttgaatcaactaatagaggaa
atagatttgcccttcttaaagacacgcagtgttaactacatggaggtaaccgtcagtgaa
tccccatcgcagaaggcaacggtgcacaggaacatctga

DBGET integrated database retrieval system