Polynucleobacter wuianus: A8O14_03960 Help Entry A8O14_03960       CDS       T09802                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pwu  Polynucleobacter wuianus Pathway pwu02024   Quorum sensing pwu03018   RNA degradation Brite KEGG Orthology (KO) [BR:pwu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     A8O14_03960  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     A8O14_03960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pwu03019]     A8O14_03960    03036 Chromosome and associated proteins [BR:pwu03036]     A8O14_03960 Messenger RNA biogenesis [BR:pwu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      A8O14_03960 Chromosome and associated proteins [BR:pwu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     A8O14_03960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ANI99321 UniProt:  A0A191UEJ8 LinkDB All DBs Position 741552..741800 Genome browser AA seq 82 aa AA seqDB search MSTNTNKIQLLQDPFLNALRKEHIPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYK HAISTIVPARAIDFRIEEGSSV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtaccaacaccaacaaaatccaattgctacaggatccatttctcaatgcattgcgc aaagagcacattcctgtttcgatctatctcgtcaatggtattaagttgcaaggcaatatt gaatcctttgatcaatatgttgtgcttcttcgcaataccgtaacgcagatggtttacaaa catgcaatctccacgatcgttcctgctcgtgcgattgatttccgcatagaagaaggcagc tctgtataa

DBGET integrated database retrieval system