KEGG   Pseudoalteromonas xiamenensis: J5O05_20770
Entry
J5O05_20770       CDS       T07215                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
pxi  Pseudoalteromonas xiamenensis
Pathway
pxi00333  Prodigiosin biosynthesis
pxi01100  Metabolic pathways
pxi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5O05_20770
SSDB
Motif
Pfam: PPDK_N PEP-utilizers Cellulase-like
Other DBs
NCBI-ProteinID: QTH73221
LinkDB
Position
unnamed5:674011..676659
AA seq 882 aa
MSSSYVVEITGNNTLERTSLGGKAHSLNHLVQAGLPVPPAFCVTAHAYEQFIGDAVPSEV
MNSGDLEQIRSAILEANLPDAIRDAIVSAYEHLGSSSDVAVRSSALDEDGQSQSFAGQYE
TYLHINGQEAVLNKVQACWASLWAERVAGYRNADASQTAIAVVLQTMVAADCAGVLFTRD
PISNREDRLVIDGCWGLGEGVVSGQVSTDTFTLDKVSGECVEKQLRHKSHYCVRQENGHI
ALVETPTEKRDSACLTAHHLEQLWTLAKQAETLYGCALDIEWAVKDDKVWLLQARPVTTT
NQASGVVYANPWEASQSIKDGAFFSRMDTGEIVTGLMTPLGLSFCEFYQKHIHGPAVKTM
GLADIGDWSIYMGYIQGQVYLNISGSAMLLRQCPPTRDQMKFTTRYATSDIDFTNYKNPY
GEGVDGWAYTKSAWHWLKQQVHNMRTAGKTVENMISLRERETKRFLAMDLASLSLAELNT
ELKRIDGYFLESCAAYMPFFLQSFALYDALAETCQHYLPNEGNGLQNRIKASMNNLRTIE
VTRGILDLVDVVAPNAELRSLFMATEADELVKILPEHPLGKVFWNNEFEAFLAEFGSRGR
QEFELSLPRWRDDPTYLLQVMKMYLEHPVDLEAKLAQTEALRQADSDALLNAMPWLGRFK
LKNIIKLYGVMAERREATRPTFITETWFYRKIILEVLGRLENQGIVSKDDLPYIDFNQFR
AYVAGEIAPQEAFSQKLLDANRHAHLLNVHAEEPPMCIIGGYTPKVKASVAEGQNSFNGL
AASPGKIVAKARVITDLQTQAKELKPGEILVAKYTDASWTPLFALAAGVITDIGSTLSHS
CIVAREFGIPAVVNLHHATTAIESGDTLILDGDEGVVIIQRE
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgagttcttcatacgtcgtagaaattacgggtaataacacgctagaaaggacgagtctc
ggtggtaaagcacactcgctaaatcacttagtacaggctggtttaccagtaccgccagcg
ttttgtgtgactgcacacgcctatgaacagtttatcggtgacgcagtgccaagcgaagtg
atgaatagcggtgatcttgagcaaattcgcagcgcgattcttgaggctaatttaccggat
gctattcgtgatgcaattgtctcagcgtatgagcatttggggtcaagtagcgatgttgcc
gtgcgctcgtcagctctggatgaagatggtcaaagtcagtcttttgcgggtcaatatgaa
acgtacctacacatcaatgggcaagaagcggtattgaataaagtgcaagcgtgttgggct
tcgctttgggctgaacgcgtcgcgggttatcgcaacgcagatgcctcacaaacggccatt
gccgttgtactgcaaacgatggtggcagctgattgtgcaggcgttttgtttacacgcgat
ccaatctcaaaccgcgaagatcgattggttattgatggttgttggggattaggagaaggc
gtcgtctctgggcaggtttctacggataccttcacgttagacaaagtgagcggagaatgt
gttgaaaaacaattgcgtcacaaatctcattattgtgtacgccaagaaaatggtcacatt
gcactggttgaaacaccaacagagaagcgcgacagtgcctgtttgacggcgcaccattta
gagcaattgtggacacttgcaaagcaagctgaaacgctttatggctgtgcattggacatc
gagtgggcagtaaaagacgacaaagtttggttgctgcaagcgcgtcctgtaacgaccacc
aatcaagcgtcgggtgttgtctatgcaaacccatgggaagcgtctcagtcaatcaaagat
ggtgcgttcttctctcgtatggacacgggggaaatcgttacaggattgatgacgccgctt
ggtctgtcattttgtgagttttaccaaaaacacattcatggcccagcggtcaaaacgatg
gggttagctgatattggtgattggtctatttacatgggctacatccaaggtcaggtttat
ctcaatatttctggttctgcgatgttgctacgtcaatgtcctccaacacgcgatcagatg
aaattcaccacgcgttacgcaacgtcagatatcgactttacgaattacaaaaacccgtat
ggcgaaggtgtcgatggatgggcatacacgaaaagtgcatggcattggttaaaacaacaa
gtccacaacatgcgtacagcagggaaaaccgttgaaaacatgatttcgcttcgcgaaaga
gaaaccaaacgcttccttgctatggacttagcgagtctttctttggcggaattgaatacg
gaattaaaacgtattgatggctacttcttggaaagttgtgctgcgtacatgccgttcttt
ttacaatcgtttgccctttatgacgcacttgctgaaacctgtcagcattatttgccaaac
gaaggtaatggattacagaaccgcattaaagcatcgatgaacaaccttcgtaccattgaa
gtgacgcgcggtatcctcgacttagtggatgttgttgcgccaaacgcagaactacgttcg
ctgttcatggccacagaagcggatgagttagtaaaaattctacccgaacacccattaggt
aaggtgttctggaacaatgaatttgaagcctttttagctgagtttggctcgcgtggtcgc
caagagtttgaattgagcttgcctcgttggcgcgatgacccaacttatttgcttcaagta
atgaaaatgtatttagagcatccggttgatttagaagctaaattggcacaaaccgaagca
cttcgacaagccgacagcgatgctctactaaatgcaatgccttggcttggacgcttcaaa
cttaaaaacatcattaagttatacggtgtgatggctgaacgacgtgaggcgacgcgtcca
acgtttatcaccgaaacatggttctatcgcaaaatcattcttgaagtccttggtcgtcta
gagaatcaagggatcgtgtcaaaagatgatttgccgtacatcgactttaaccaattccgt
gcatacgttgccggcgaaattgcgccgcaagaggcattttctcaaaaattgctggacgcg
aatcgccacgctcacttattgaatgtacatgctgaagaacctccaatgtgcatcatcggt
ggctatacaccaaaggtcaaagcttcagtggccgagggccaaaattcatttaatggactt
gccgcaagtcctggaaaaattgtagctaaggcccgtgtcattacagatttacaaacgcaa
gccaaagagctgaaaccaggcgaaattctcgtggcgaaatacacagatgcgagttggaca
ccactttttgccttggcggcgggtgttatcacagacattggttcgacactttctcatagc
tgtattgtcgcgagggaattcggtattcccgcggtggtcaatttacaccatgcaacaacg
gcgattgaaagcggcgataccttaatcctcgacggtgatgagggcgtggtcattattcaa
cgcgagtaa

DBGET integrated database retrieval system