KEGG   Papilio xuthus (Asian swallowtail): 106121746
Entry
106121746         CDS       T07456                                 
Name
(RefSeq) methylenetetrahydrofolate reductase
  KO
K25009  methylenetetrahydrofolate reductase [NAD(P)H] [EC:1.5.1.20]
Organism
pxu  Papilio xuthus (Asian swallowtail)
Pathway
pxu00670  One carbon pool by folate
pxu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106121746
Enzymes [BR:pxu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106121746
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-GeneID: 106121746
NCBI-ProteinID: XP_013172999
LinkDB
Position
Unknown
AA seq 272 aa
MSELLKISDLIRNKRSFTFSFEVTPDVGEAELDKITLQPEFYSITWHALSHQCKDLNIAP
LKLANLLRRKHKHVLLNLSCNLMTKAYLNDLLPWLQEKEICNLFIVLGDSFNANRSDFKT
SSEMISYIRAKTSDYFCIGVAGFPYDDCKITALKEKIDLGADFVISQAFFESNVYKNYLE
KCKDAKIDVPIIPGIFPFQSQKELDMFLKLCKVKVTEEFRMKLEEKSENVMDIIENLVLD
LRNNLNVKHFHFFTINKLGITCELVKNIQLSL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtctgaattattaaaaattagcgacttaattagaaacaaacgttcctttacattttca
tttgaagtgaccccagatgtcggtgaggctgaacttgataagattacacttcagccagaa
ttctattcaataacttggcacgctctgagccatcagtgtaaagatttaaatattgctcca
ttaaagttagcaaacttattaaggcgaaaacataaacatgttttattaaatttatcgtgt
aatcttatgaccaaagcgtatttaaatgacttactaccatggcttcaggaaaaggaaatt
tgcaatttgtttatagttttaggagattctttcaatgccaatcgatctgattttaagacg
tcctctgaaatgatatcctatataagagcgaaaacatcggactatttttgtattggcgtt
gccggttttccatatgacgattgtaaaattacagcattaaaagaaaaaattgatctagga
gctgattttgtaatatcacaagcatttttcgaatcaaatgtttacaagaattatctcgaa
aaatgcaaagacgcaaaaatagatgtgcccataatacccggtatatttccttttcaatcg
caaaaagaattggatatgttcttaaagttatgtaaggttaaggtaactgaggaattcaga
atgaaattggaagaaaaatcggaaaatgtgatggatattatagaaaatctagtacttgat
ttacgtaataatttaaatgtaaaacatttccattttttcacgataaataaacttggaata
acttgcgaattggttaagaacattcaactgtcgttatga

DBGET integrated database retrieval system