KEGG   Plutella xylostella (diamondback moth): 105382422
Entry
105382422         CDS       T03915                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105382422
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pxy00199]
    105382422
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105382422
Cytochrome P450 [BR:pxy00199]
 Cytochrome P450, animal type
  CYP306 family
   105382422
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105382422
NCBI-ProteinID: XP_011550602
LinkDB
Position
Un
AA seq 540 aa
MDLFFVWLMTFVLGFWICKKIKEWQNLPPGPWGLPILGYLPFLNPKHPHLTLTELSKKYG
SIYGIWMGNIYTVVLSDHKLIREAFAKESFAGRAPLYLTHGIMQGNGIICAEGSLWKDQR
KLITMWLKGFGMSKHSASRDKLEQRIGDGVQNLLQDIKRNCDNSIDLSQMLSNSLGNVVN
EIVFGYKFPPDDKTWTWLRQIQEEGCHEMGVAGVVNFLPFIRYFSSDMRKTIEVLKRGQA
QTHRFYASMIAKRRELLGLKKPVGAEYPPHDNLFDEHPDGHIKCVKYSKHAQTTDEHFFD
PSILIPTEGDCILDSYLHEQKRRFEDGDDLARFVSDEQMHYLLADMFGAGLDTTAVTLAW
FLLYMALYPDEQELVREEILSVCPSEGAVDGAMLPRLMAAVCEAQRIRSIVPVGVPHGCL
QETYVGKYRVPAGAMVVPLQWAVHMDERVWADPEEFRPARFLDQDGSLLKPQEFIPFQTG
KRMCPGDELSRMLACGLVARLLRHWRLRLASPPPSPQEMRGVVGVTLAPPRVLYRCEPVA
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggatttgtttttcgtgtggctgatgacctttgtcctcggattttggatttgtaaaaag
ataaaggaatggcagaatttgccgccgggcccgtggggattgccaattctaggatatttg
ccattcctgaatcccaaacatccacatttgacgttgactgagttatctaaaaagtatgga
tcaatatacggtatatggatgggcaacatttacacggtggtcctctctgaccacaagctc
ataagagaagcatttgcaaaggaatcattcgccggtcgtgcacctctttacttgacccac
gggattatgcaaggaaatggtatcatatgcgccgaaggaagtctgtggaaggaccagagg
aagttaataacgatgtggttgaaagggttcggcatgagcaagcacagcgcgtcccgagac
aagctggagcaacgcatcggcgacggagtgcagaacctcctgcaggatataaagagaaac
tgcgataatagcattgatctcagccagatgctgagtaattctctgggaaatgtggtgaat
gaaatagtatttgggtacaagtttccacccgacgacaagacgtggacgtggctgcggcag
atacaggaggagggctgccacgagatgggcgtcgccggggtcgtcaacttcttgcctttt
attcggtatttctcatccgacatgagaaagactatagaagtactaaaacgggggcaagcg
caaactcatcggttctacgccagcatgatagccaaaaggcgggagctgctaggcctcaag
aaacccgtcggagcggagtaccctccacacgacaacctcttcgacgagcacccagacggc
cacatcaagtgcgtcaagtacagcaaacacgctcaaaccactgacgagcacttcttcgat
ccgtcgattctaataccgactgaaggggattgcatactggacagctatcttcacgagcag
aagcgaaggttcgaggatggtgatgatctggcgcggtttgtaagcgacgaacagatgcac
tatctgttggcggacatgttcggcgcggggctcgacaccacggccgtcaccctggcgtgg
ttcctgttatacatggcgctctacccggacgaacaggaacttgtgcgtgaggagatactg
tcggtgtgtccgagcgagggcgcggtggacggcgccatgttgcctcggctgatggcggcc
gtgtgcgaggcgcagcggatccgctccatcgtgcctgtcggcgttccgcatggctgttta
caggaaacctacgttggcaagtacagagtaccggcaggagccatggtggtgccgcttcag
tgggccgttcatatggacgagcgagtgtgggcggaccctgaggaattccgccccgccagg
ttcctcgaccaggacggcagtctgctgaaacctcaggagttcatacccttccagacaggc
aagcgcatgtgccccggggacgagctctcgcgcatgctggcatgcgggctggtggcgcgg
ctgctgcggcactggcgcctgcgccttgcgtccccacccccctccccgcaggagatgcgg
ggggtggtcggggtcaccctcgccccgccgagagtgttgtatcggtgtgagcctgtggct
taa

DBGET integrated database retrieval system