KEGG   Pyrococcus kukulkanii: TQ32_04640
Entry
TQ32_04640        CDS       T04365                                 

Definition
(GenBank) 6-pyruvoyl tetrahydropterin synthase
  KO
K22102  dihydroneopterin phosphate aldolase [EC:4.1.2.59]
Organism
pyc  Pyrococcus kukulkanii
Pathway
pyc00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pyc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TQ32_04640
Enzymes [BR:pyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.59  dihydroneopterin phosphate aldolase
     TQ32_04640
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: AMM53848
UniProt: A0A127B992
LinkDB
Position
880496..880843
AA seq 115 aa
MKARLIVKTSFDAAHAVKIGSDWEELHGHTFFLEVVVEGSIKHGYIMDFVRLRKIIEGIT
KELDHKNLNKIFDNPTTENIALWLADKIKEKLPDKVILRRLVLWEGSDYGVELEW
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaagcaaggctaattgttaagacaagctttgacgctgcacatgcagttaaaataggt
agcgattgggaggaactacacggacacacgttcttcttagaagttgttgttgaaggatcg
ataaagcatggttatataatggactttgtaaggctcaggaaaatcattgagggaataact
aaggagcttgaccacaagaacctaaacaagatctttgataatccaactactgagaacata
gccttgtggctcgcggataaaataaaggagaagttgccggacaaggtgattttaagaagg
ctggttctctgggaagggagtgattatggggtggagctagagtggtga

DBGET integrated database retrieval system