KEGG   Pyrococcus sp. ST04: Py04_1638
Entry
Py04_1638         CDS       T02124                                 

Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K17753  isocitrate--homoisocitrate dehydrogenase [EC:1.1.1.286]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00020  Citrate cycle (TCA cycle)
pys00300  Lysine biosynthesis
pys01100  Metabolic pathways
pys01110  Biosynthesis of secondary metabolites
pys01120  Microbial metabolism in diverse environments
pys01210  2-Oxocarboxylic acid metabolism
pys01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Py04_1638
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Py04_1638
Enzymes [BR:pys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.286  isocitrate---homoisocitrate dehydrogenase
     Py04_1638
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: AFK23208
UniProt: I3RG48
LinkDB
Position
complement(1611999..1613039)
AA seq 346 aa
MYRVAVIKGDGIGPEVINAAIEVVNSITSKIRFYEFEGGVEVFKRYGVPITEEDLEQIRK
MDAVLFGATTTPFDLPGYKSLIITLRQELDLYANLRIIPDLRNGREIVIVRENSEGLYSG
QGRAYEDKAVDVRLITRRGAERIARFAARIAKDRNSFITFVHKANVLTSDKYFRKIVFEV
AREEGVEVREAIVDSFTIKLVRNPWNHGVILSENLFGDILSDLATIHAGSIGIVPTGNYG
ENIALFEPIHGSAPDIAGKGIANPIGAILSAAMMLDYLGLDGRRIWDAVRSYVAKGNLTP
DMGGTATTMEVTRGIIAEIHSLDPLDLDEMWMEEVRLGRIPLRMDE
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtatagagtagcagtcataaagggagatggaattggacctgaggtcatcaatgctgca
atcgaagttgttaactctattaccagcaaaataagattttatgagtttgagggaggagta
gaggtctttaaaagatatggtgtgccaataaccgaagaggatttggaacagataagaaaa
atggatgccgtgttatttggggcgacaacgaccccatttgacctgcctggatataagagc
ctaataataactcttagacaggagcttgatctttatgccaacttgaggataataccagat
ttgagaaatgggcgggaaatagttatagtaagggaaaacagcgaagggctgtattctggc
cagggtagggcctatgaggataaggctgtggatgtcaggttaatcacaaggagaggagcc
gaaaggatagctagatttgctgcaagaattgcaaaggacaggaattcatttataacattt
gttcataaggcgaatgttcttacaagtgataagtactttaggaaaatagttttcgaggtt
gctagagaagaaggagtcgaagtaagggaagcaatagtcgattcatttacaataaaactt
gtgaggaatccttggaatcatggtgtgatacttagtgaaaacttgtttggggatatactt
tctgatttggcgacgattcatgctgggagcataggaatagtgcccactggtaactatgga
gagaacatagcattgtttgaacctatacatgggtcagcacctgatattgcaggaaagggt
atcgcaaatccaattggagctattctaagtgcggcaatgatgcttgattatcttggcctg
gatggaaggagaatctgggatgctgtcaggagctatgtggcaaaaggtaacttgactccc
gatatgggaggaactgcaactactatggaagttacgcggggaataattgctgaaatacac
tctttagatccccttgacttggatgaaatgtggatggaggaggttaggctcgggagaata
cctctaaggatggatgagtaa

DBGET integrated database retrieval system