KEGG   Puma yagouaroundi (jaguarundi): 121036009
Entry
121036009         CDS       T07555                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pyu  Puma yagouaroundi (jaguarundi)
Pathway
pyu04927  Cortisol synthesis and secretion
pyu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pyu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    121036009
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    121036009
SSDB
Motif
Pfam: MRAP FixQ EVC2_like
Other DBs
NCBI-GeneID: 121036009
NCBI-ProteinID: XP_040339983
LinkDB
Position
Unknown
AA seq 111 aa
MANQTNASTLYDSYEYYLDYVDLIPVDERKLKANKYLIVIAFWVSLAFFVMLLFLILLYM
SWSGSSQVRNNAQHHPTRPWSHGLNLPLCVRRHPTGSPGLGQGARQQSIPP
NT seq 336 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacgcctccaccctgtacgacagctacgaatactacttggactac
gtggacctcattcccgtggatgagaggaagctgaaagccaacaaatatctgattgtcatt
gccttctgggtgagcctggcatttttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcagggtcctcgcaggtgaggaacaacgcccagcaccatccaacacgcccctgg
agccacggcctcaacctcccactctgtgtccggaggcaccccacaggctcccctgggctc
gggcaaggagccaggcagcagagcatcccgccctga

DBGET integrated database retrieval system