KEGG   Quercus lobata (valley oak): 115975064
Entry
115975064         CDS       T07350                                 

Name
(RefSeq) anthocyanidin 5,3-O-glucosyltransferase-like
  KO
K12938  anthocyanidin 5,3-O-glucosyltransferase [EC:2.4.1.-]
Organism
qlo  Quercus lobata (valley oak)
Pathway
qlo00942  Anthocyanin biosynthesis
Brite
KEGG Orthology (KO) [BR:qlo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00942 Anthocyanin biosynthesis
    115975064
Enzymes [BR:qlo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     115975064
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 115975064
NCBI-ProteinID: XP_030951562
LinkDB
Position
2
AA seq 299 aa
MLLVDIPGLPSVRVSDMPKITFDPTTKMYEYFLNTATHMANSNGLALNVFDLLETKAFEA
ISSGLCVPDGPTLPIFCIGPLISNTNQDGEEHECLNWLNLQPSRSVVFLCFGSLGSFSEK
QVKEIAVGLENSGQRFLWVVRNPPPDTDKDPNLDELLPTGFLERTKDKGFVVKQWAPQVA
VLSHDSVGGFVTHCGWNSVLEAVWCGVPMVGWPLYVEKRLNRVVLVTETKLALELNESED
GFVSATELEKRVKELMDSEVGTKLRERVSGLRDEAVSAVKEGGSSHVALAKLAEVWRQN
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcttcttgttgatattcctggtttaccttctgtccgggtttcagacatgcccaaaatt
acgtttgatcccaccactaaaatgtacgaatattttcttaacactgcaacccacatggcc
aattcaaatggacttgctctaaacgtgttcgacttgctcgaaacaaaagctttcgaggca
atctctagtggactctgtgtcccagatggaccaactctgccaattttctgtattggacct
ttgatatcaaacaccaatcaagatggagaagagcacgagtgtttgaattggctaaactta
caaccgagtcgaagcgttgtgtttctatgtttcggaagcttgggatcgttttcggagaag
caggtgaaagaaattgcggtgggtttagaaaatagcggtcaaagatttttgtgggttgtg
agaaatccaccaccagatacggataaagatccaaacttggatgaattgttgccaacgggt
ttcttggaaaggaccaaagataagggatttgtggtgaaacaatgggctccacaggtggca
gtgttgagtcatgactcagtgggagggttcgtgactcactgtgggtggaactcagtgctt
gaagcggtttggtgtggagtgccgatggttggttggcctttgtacgtagagaaaaggttg
aatagggtggttttggtgacggaaaccaagttagctttggagttaaacgagtcggaagat
gggtttgtgagtgcaactgagttagagaagcgagtgaaggagttaatggattcggaagtt
gggacaaaactgagagaaagggtttcgggtttgagagatgaagcagtgtctgctgtgaaa
gagggtgggtcctctcatgttgcattggcgaaattggctgaggtgtggcggcaaaactaa

DBGET integrated database retrieval system