KEGG   Quercus suber (cork oak): 111989736
Entry
111989736         CDS       T05868                                 
Name
(RefSeq) aromatic peroxygenase-like
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111989736
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     111989736
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 111989736
NCBI-ProteinID: XP_023877298
LinkDB
Position
Unknown
AA seq 316 aa
MANHGYLNRNGITTFAQAANACQITLGFGYDTCVFLSALGLLSGGDLPSGKYSIGGADSR
VPNTLGPSLGISKHGFFEVDNSISREDAYFGNAADFKLDRFNRLVNITKKYGGEFGNSAF
AEERVVVYNEAKNINPEFDAGIRWLAVTTAERVFIFRAMPNGTHETLADNQNVLPFYLNE
TFPEHWFRRATPYSLVDTGADIANLILSSSQLTIPGQNQGFDNFVPIGLDLASVTPETAV
CFLASSVFDETPGFLSPALVDNFDTVSAFLNGALAPFFSSSNCDLAQYGAPGKNASNADV
GPSAECNILVNGVYKC
NT seq 951 nt   +upstreamnt  +downstreamnt
atggccaaccacggctacttgaaccgcaacggaattaccaccttcgcccaggctgccaat
gcttgccaaattactcttggcttcggctacgacacctgcgtcttcctctctgcccttggc
ttgctctcaggtggtgacttgccatctggcaaatactctatcggaggtgcggactcacgt
gtcccaaacactcttggcccatctcttggtatctccaagcacggcttcttcgaggtcgac
aactccatctcccgtgaggatgcttactttggcaatgctgccgacttcaagctcgaccgt
ttcaaccgcctggtcaacatcaccaagaagtacggtggtgagtttggtaactctgctttc
gccgaggagcgtgttgttgtctacaacgaggctaagaacatcaaccctgagtttgatgct
ggtattcggtggttggctgtcaccactgctgagcgtgtcttcatcttccgcgccatgccc
aacggtacccacgagactcttgccgacaaccagaacgtccttccattctacttgaacgag
accttcccagaacactggttccgccgcgccaccccatactcccttgtcgacactggtgcc
gacattgccaacctcattctctcttcatctcagctcaccattcccggccagaaccagggc
ttcgacaacttcgtgccaattggcctcgatcttgccagcgttacccctgagactgccgtc
tgcttcctcgcttcgtctgtcttcgacgagacccctggctttctctcccctgccctggtt
gacaacttcgacactgtctctgccttcttgaacggtgctttggctcctttcttctccagc
tccaactgcgacctcgcccagtacggtgctccgggcaagaacgcttccaacgctgatgtt
ggtcccagtgccgagtgcaacatcctcgtcaacggtgtgtacaagtgctaa

DBGET integrated database retrieval system