KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513130
Entry
107513130         CDS       T06036                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107513130 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ray04050]
    107513130 (TNFRSF8)
   04090 CD molecules [BR:ray04090]
    107513130 (TNFRSF8)
Cytokine receptors [BR:ray04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107513130 (TNFRSF8)
CD molecules [BR:ray04090]
 Proteins
  107513130 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 107513130
NCBI-ProteinID: XP_016004927
LinkDB
Position
Unknown
AA seq 620 aa
MWQPWNPRPSSDPASQVTLGKVCSLGRECSHVKHRSCTDMFGEFRGIAEKGFRDERWGDG
TFAEAAWPGASPLLSPGLSPQQPCPQKSSDCRKQCEQDYYVDSDGRCTACVSCRDDLVEK
QPCSWNSSRVCECRAGTFCVTSATNSCARCSPHSVCPAGKIVKFQGTAERDTVCEWPSPG
TSRDCSTDPEDCKALARDTTPQAKPIVTSASSNAGTTLLGGGRTPEGDSKMMRAPSPALS
AGRPGPGPGLSPQKLCPQGSSNCRKQCEQDYYLGGDGRCTACVSCSGDDLVEKTPCTWNS
SRVCECRPGMFCVTLATNSCARCVACPVSPPGMVQGTAERDTTHGPPPLGTHPNCSTNPE
DIKMPASTVPSRIPLSEGHGGGVTHAWGYTFISTSVPISFPSRGRPLLVSGPALLWLVLV
LVVVVGSSAFLLCHRRACWKWIRQKLHLCYPVQTFRPKPEPVGSRPQRNPIQLKRSPSVA
EPCAGALRLSPLAVATCPDVGTTCPERLRLLDASPVSSPPALGDAPEPRVTAEHTNNRIE
KIYIMKADTVIVGTVKTEAPEGRGLAGAAEPELEDDLEVDHAPHYPEQETEPPLGSCGSV
MFSVEEEGKEEPLPMTASGK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgtggcagccctggaatcccaggcccagctctgatcctgcctcccaggtgaccttgggc
aaggtctgctcgcttgggcgtgagtgctcccatgtaaaacacaggagttgcactgacatg
ttcggggagttcaggggtattgctgagaagggcttcagggatgagaggtggggggatggg
acctttgccgaggcggcctggcccggagcttctccgcttctctccccagggctgtcccca
cagcagccatgcccacagaagtcatccgactgcaggaagcagtgtgagcaggactactac
gtggacagcgatggccgctgcacggcctgcgtgagctgcagagatgacctcgtggagaag
cagccgtgctcgtggaactcctcccgcgtctgcgagtgccgggctggcacgttctgtgtc
acgtcagccaccaactcctgcgcccgctgctccccgcactctgtctgccccgcagggaag
atcgtcaagttccagggtacagcggagagggacacagtctgtgagtggccctccccaggg
accagccgtgactgcagcactgacccagaggactgcaaggcgctggccagggacaccacc
ccccaggccaaacccatcgtgacctcagcaagctccaatgccgggaccacgcttcttgga
gggggccgcaccccggaaggtgattccaaaatgatgcgggctcccagccctgccctctcc
gcagggaggcccgggccagggccagggctgtccccgcagaagctgtgccctcaggggtcc
agcaactgcaggaagcagtgtgagcaggactactacctgggcggggacggccgctgcacg
gcctgcgtgagctgttcgggagatgacctcgtggagaagacgccttgcacgtggaactcc
tcccgcgtctgcgaatgtcggcctggcatgttctgtgtcacgctggccaccaactcctgc
gcccgctgcgtcgcctgtcccgtctccccgccggggatggtccagggtacagctgagcgg
gacaccacccacggaccacctcccctggggacccaccccaactgcagcaccaatccagag
gacatcaaaatgcctgccagcactgtcccctcccggatccccctgtccgaggggcatgga
gggggtgtcacccatgcctgggggtacaccttcatctcaacgagtgttcccatctctttc
ccctccaggggaaggccccttctggtttcagggcccgcgctcctctggttggtcctcgtg
ctggtcgtggtcgtcggctccagcgccttcctcctgtgccaccgcagggcctgctggaag
tggattcggcagaagctccacctgtgctacccagtccagaccttccggccgaagccagag
cccgtgggttccaggccccagaggaaccccatacagctgaagcggagcccgtcggtggcg
gagccctgcgcaggcgcgctgaggctgagccccctggccgtggccacctgccccgacgtg
gggacgacctgccccgaaaggctgcggctgctggatgccagcccagtgagcagccccccg
gccctcggggacgctcccgagccccgggtcaccgcggagcacaccaacaacaggatcgag
aaaatctacatcatgaaggccgacacagtgattgtggggaccgtgaagaccgaggcgccc
gagggccggggcctggcgggggcggcagagcctgagcttgaggacgacctggaagtggac
cacgcgccacactacccagagcaggagaccgaaccgcctctgggcagctgcgggagcgtc
atgttctcggtcgaggaggaggggaaggaggagcccttgcccatgactgcctctgggaaa
tga

DBGET integrated database retrieval system